KEGG   Equus caballus (horse): 100061755
Entry
100061755         CDS       T01058                                 

Gene name
BAK1
Definition
(RefSeq) bcl-2 homologous antagonist/killer
  KO
K14021  Bcl-2 homologous antagonist/killer
Organism
ecb  Equus caballus (horse)
Pathway
ecb01524  Platinum drug resistance
ecb04141  Protein processing in endoplasmic reticulum
ecb04210  Apoptosis
ecb04215  Apoptosis - multiple species
ecb05022  Pathways of neurodegeneration - multiple diseases
ecb05132  Salmonella infection
ecb05160  Hepatitis C
ecb05162  Measles
ecb05163  Human cytomegalovirus infection
ecb05164  Influenza A
ecb05165  Human papillomavirus infection
ecb05167  Kaposi sarcoma-associated herpesvirus infection
ecb05168  Herpes simplex virus 1 infection
ecb05169  Epstein-Barr virus infection
ecb05170  Human immunodeficiency virus 1 infection
ecb05200  Pathways in cancer
ecb05202  Transcriptional misregulation in cancer
ecb05203  Viral carcinogenesis
ecb05206  MicroRNAs in cancer
ecb05210  Colorectal cancer
ecb05212  Pancreatic cancer
ecb05213  Endometrial cancer
ecb05214  Glioma
ecb05216  Thyroid cancer
ecb05217  Basal cell carcinoma
ecb05218  Melanoma
ecb05220  Chronic myeloid leukemia
ecb05222  Small cell lung cancer
ecb05223  Non-small cell lung cancer
ecb05224  Breast cancer
ecb05225  Hepatocellular carcinoma
ecb05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100061755 (BAK1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100061755 (BAK1)
   04215 Apoptosis - multiple species
    100061755 (BAK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100061755 (BAK1)
   05202 Transcriptional misregulation in cancer
    100061755 (BAK1)
   05206 MicroRNAs in cancer
    100061755 (BAK1)
   05203 Viral carcinogenesis
    100061755 (BAK1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100061755 (BAK1)
   05212 Pancreatic cancer
    100061755 (BAK1)
   05225 Hepatocellular carcinoma
    100061755 (BAK1)
   05226 Gastric cancer
    100061755 (BAK1)
   05214 Glioma
    100061755 (BAK1)
   05216 Thyroid cancer
    100061755 (BAK1)
   05220 Chronic myeloid leukemia
    100061755 (BAK1)
   05217 Basal cell carcinoma
    100061755 (BAK1)
   05218 Melanoma
    100061755 (BAK1)
   05213 Endometrial cancer
    100061755 (BAK1)
   05224 Breast cancer
    100061755 (BAK1)
   05222 Small cell lung cancer
    100061755 (BAK1)
   05223 Non-small cell lung cancer
    100061755 (BAK1)
  09164 Neurodegenerative disease
   05022 Pathways of neurodegeneration - multiple diseases
    100061755 (BAK1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100061755 (BAK1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100061755 (BAK1)
   05160 Hepatitis C
    100061755 (BAK1)
   05164 Influenza A
    100061755 (BAK1)
   05162 Measles
    100061755 (BAK1)
   05168 Herpes simplex virus 1 infection
    100061755 (BAK1)
   05163 Human cytomegalovirus infection
    100061755 (BAK1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100061755 (BAK1)
   05169 Epstein-Barr virus infection
    100061755 (BAK1)
   05165 Human papillomavirus infection
    100061755 (BAK1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100061755 (BAK1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:ecb03029]
    100061755 (BAK1)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ecb02000]
    100061755 (BAK1)
Mitochondrial biogenesis [BR:ecb03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    100061755 (BAK1)
Transporters [BR:ecb02000]
 Other transporters
  Pores ion channels [TC:1]
   100061755 (BAK1)
SSDB
Motif
Pfam: Bcl-2 Bcl-2_3 DUF4389
Other DBs
NCBI-GeneID: 100061755
NCBI-ProteinID: XP_005603876
Ensembl: ENSECAG00000023902
VGNC: 15761
UniProt: F6XWS9
LinkDB
Position
20
AA seq 211 aa
MASGQGPGPPGKECGEPAPSSTSEEQVARDTEEVFRSYVYYRHQQEQEAEGAAAPADPEM
DTLPLEPNSTMGQVGRQLAIIGDDINRRYDSEFQTMLKHLQPTAENAYELFTKIASSLFE
SGINWGRVVALLGFGYRLALHVYQRGLTGFLSQLTRFVAEFMLHHCIARWIAQRGGWVAA
LDLGNGPIRNVLIVLAVVLLGQYVVRRFFKS
NT seq 636 nt   +upstreamnt  +downstreamnt
atggcgtccgggcaaggcccaggtcctccggggaaggagtgcggagagcctgccccgtcc
tccacttctgaggagcaggtagcccgggacacggaggaggttttccgcagctacgtttat
taccgccaccagcaggagcaggaggccgagggggcggctgcgcccgccgacccagagatg
gacaccctgcccctggaacctaacagcaccatggggcaggtggggcggcagctcgccatc
atcggggacgacatcaatcggcgctacgactcggagttccagaccatgctgaagcacctg
cagccaacagcagagaacgcctatgagctgttcaccaagatcgcctcgagcctgtttgag
agcggcatcaactggggccgagtggtggctctcctggggttcggctaccgcctggccctg
catgtctaccagcgcggcctgaccggcttcctgagccagttgacccgcttcgtggctgaa
ttcatgctgcatcactgcattgcccggtggatcgcacagaggggcggctgggtggcggct
ctggacttgggaaatggccccatccggaatgtgctgatagttctggctgtggttctgttg
ggccagtatgtggtacgaagattcttcaagtcatga

DBGET integrated database retrieval system