KEGG   Equus caballus (horse): 100061779
Entry
100061779         CDS       T01058                                 

Gene name
RASSF1
Definition
(RefSeq) ras association domain-containing protein 1 isoform X1
  KO
K09850  Ras association domain-containing protein 1
Organism
ecb  Equus caballus (horse)
Pathway
ecb04014  Ras signaling pathway
ecb04390  Hippo signaling pathway
ecb04392  Hippo signaling pathway - multiple species
ecb05200  Pathways in cancer
ecb05206  MicroRNAs in cancer
ecb05219  Bladder cancer
ecb05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100061779 (RASSF1)
   04390 Hippo signaling pathway
    100061779 (RASSF1)
   04392 Hippo signaling pathway - multiple species
    100061779 (RASSF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100061779 (RASSF1)
   05206 MicroRNAs in cancer
    100061779 (RASSF1)
  09162 Cancer: specific types
   05219 Bladder cancer
    100061779 (RASSF1)
   05223 Non-small cell lung cancer
    100061779 (RASSF1)
SSDB
Motif
Pfam: RA Nore1-SARAH C1_1 Mst1_SARAH
Other DBs
NCBI-GeneID: 100061779
NCBI-ProteinID: XP_014587141
Ensembl: ENSECAG00000012280
VGNC: 52425
LinkDB
Position
16
AA seq 340 aa
MSAEPELIELRELTPERRAGPGRTRLERANALRIAPGTARNPARQLVPGRGHRFQPAGPA
THTWCDLCGDFIWGVVRKGLQCAHCKFTCHYRCRALVRLDCCGPRDLGWEPALERDTNVD
EPVEWETPDLSQAEIEQKIKEYNGQINSNLFMSLNKDGSYTGFIKVQLKLVRPVSVPSSK
KPPSLQDARRGPGRGTAVRRRTSFYLPKDAVKHLHVLSRTRAREVIEALLRKFLVVDDPR
KFALFERAERHGQVYLRKLSDDEQPLRLRLLAGPNEKALSFVLKENDSGEVNWDAFSMPE
LHNFLRILQREEEEHLRQILQKYSYCRQKIQEALHACPLG
NT seq 1023 nt   +upstreamnt  +downstreamnt
atgtccgctgagcctgagctcattgagctgcgagaactgacacccgagcggcgcgccggc
ccgggccgcacccggctggagcgcgccaacgcgctgcgcatcgcgccgggcaccgcgcgc
aacccagcgaggcagctggtcccaggccgcggccaccgcttccagcctgcggggcccgcc
acgcacacgtggtgcgacctctgcggcgacttcatctggggcgtcgtgcgcaagggcctg
cagtgcgcgcattgcaagttcacctgccactaccgatgccgcgcgctcgtccgcctggac
tgctgcgggccccgggacctgggatgggaaccggcgctggagcgggacacaaacgtggac
gagcctgtggagtgggagacacctgacctttctcaggctgagattgagcagaagatcaag
gagtacaatggccagatcaacagcaacctcttcatgagcctgaacaaggatggctcctac
acaggcttcatcaaggttcaactgaagctagtgcgccctgtctcagtgccctccagcaag
aagccaccctccttgcaggatgcccggcggggcccagggcgtggcacagctgtgaggcgc
cgcacttccttctacctccccaaggatgctgtcaagcacctgcatgtgctgtcacgcaca
cgggcacgcgaggtcattgaggctctgctgcgcaagttcttggtggtagatgacccccgc
aagtttgcactctttgagcgggctgagcgccatggccaagtgtacctccggaagctgtct
gatgatgagcagcccctgcgactgcggctccttgcagggcccaatgagaaagccctaagc
tttgtcctgaaggagaatgactctggggaggtgaactgggacgccttcagcatgcctgaa
ctacacaacttcctacgcatcctgcagcgggaggaagaagaacacctccgccagatcctg
cagaagtactcctattgtcgccagaagatccaggaggccctgcatgcctgccccctgggg
tga

DBGET integrated database retrieval system