KEGG   Equus caballus (horse): 100061811Help
Entry
100061811         CDS       T01058                                 

Gene name
NDUFA2
Definition
(RefSeq) NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2
  KO
K03946  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 2
Organism
ecb  Equus caballus (horse)
Pathway
ecb00190  Oxidative phosphorylation
ecb01100  Metabolic pathways
ecb04714  Thermogenesis
ecb04723  Retrograde endocannabinoid signaling
ecb04932  Non-alcoholic fatty liver disease (NAFLD)
ecb05010  Alzheimer disease
ecb05012  Parkinson disease
ecb05016  Huntington disease
Module
ecb_M00146  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    100061811 (NDUFA2)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    100061811 (NDUFA2)
  09159 Environmental adaptation
   04714 Thermogenesis
    100061811 (NDUFA2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100061811 (NDUFA2)
   05012 Parkinson disease
    100061811 (NDUFA2)
   05016 Huntington disease
    100061811 (NDUFA2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100061811 (NDUFA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: L51_S25_CI-B8
Motif
Other DBs
NCBI-GeneID: 100061811
NCBI-ProteinID: XP_001504210
Ensembl: ENSECAG00000023131
VGNC: 20623
LinkDB All DBs
Position
Unknown
AA seq 99 aa AA seqDB search
MAAAAASRGLRANLGLREIRIHLCQRSPGSQGVRDFIEKRYVELKKANPDLPILIRECSD
VQPKLWARYAFGQEKNVSLNNFSADQVTRALENVLSGKA
NT seq 300 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggccgcggcgagtcgagggctccgggccaacctgggccttcgtgagattcgc
atccacttatgccagcgctcgcccggcagccagggcgtcagggacttcatcgagaaacgc
tatgtggagctgaagaaggcgaaccccgacctgcccatcttaatccgcgagtgctccgat
gtgcagcccaagctctgggcccgctacgcatttggccaagagaagaatgtctctttgaac
aacttcagtgctgatcaggtaaccagagccctggaaaatgtgctaagtggcaaagcctga

DBGET integrated database retrieval system