KEGG   Equus caballus (horse): 100062044
Entry
100062044         CDS       T01058                                 

Gene name
TP53
Definition
(RefSeq) cellular tumor antigen p53
  KO
K04451  tumor protein p53
Organism
ecb  Equus caballus (horse)
Pathway
ecb01522  Endocrine resistance
ecb01524  Platinum drug resistance
ecb04010  MAPK signaling pathway
ecb04071  Sphingolipid signaling pathway
ecb04110  Cell cycle
ecb04115  p53 signaling pathway
ecb04137  Mitophagy - animal
ecb04151  PI3K-Akt signaling pathway
ecb04210  Apoptosis
ecb04211  Longevity regulating pathway
ecb04216  Ferroptosis
ecb04218  Cellular senescence
ecb04310  Wnt signaling pathway
ecb04722  Neurotrophin signaling pathway
ecb04919  Thyroid hormone signaling pathway
ecb05012  Parkinson disease
ecb05014  Amyotrophic lateral sclerosis
ecb05016  Huntington disease
ecb05160  Hepatitis C
ecb05161  Hepatitis B
ecb05162  Measles
ecb05163  Human cytomegalovirus infection
ecb05165  Human papillomavirus infection
ecb05166  Human T-cell leukemia virus 1 infection
ecb05167  Kaposi sarcoma-associated herpesvirus infection
ecb05168  Herpes simplex virus 1 infection
ecb05169  Epstein-Barr virus infection
ecb05200  Pathways in cancer
ecb05202  Transcriptional misregulation in cancer
ecb05203  Viral carcinogenesis
ecb05205  Proteoglycans in cancer
ecb05206  MicroRNAs in cancer
ecb05210  Colorectal cancer
ecb05212  Pancreatic cancer
ecb05213  Endometrial cancer
ecb05214  Glioma
ecb05215  Prostate cancer
ecb05216  Thyroid cancer
ecb05217  Basal cell carcinoma
ecb05218  Melanoma
ecb05219  Bladder cancer
ecb05220  Chronic myeloid leukemia
ecb05222  Small cell lung cancer
ecb05223  Non-small cell lung cancer
ecb05224  Breast cancer
ecb05225  Hepatocellular carcinoma
ecb05226  Gastric cancer
ecb05230  Central carbon metabolism in cancer
ecb05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100062044 (TP53)
   04310 Wnt signaling pathway
    100062044 (TP53)
   04071 Sphingolipid signaling pathway
    100062044 (TP53)
   04151 PI3K-Akt signaling pathway
    100062044 (TP53)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    100062044 (TP53)
  09143 Cell growth and death
   04110 Cell cycle
    100062044 (TP53)
   04210 Apoptosis
    100062044 (TP53)
   04216 Ferroptosis
    100062044 (TP53)
   04115 p53 signaling pathway
    100062044 (TP53)
   04218 Cellular senescence
    100062044 (TP53)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    100062044 (TP53)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100062044 (TP53)
  09149 Aging
   04211 Longevity regulating pathway
    100062044 (TP53)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100062044 (TP53)
   05202 Transcriptional misregulation in cancer
    100062044 (TP53)
   05206 MicroRNAs in cancer
    100062044 (TP53)
   05205 Proteoglycans in cancer
    100062044 (TP53)
   05203 Viral carcinogenesis
    100062044 (TP53)
   05230 Central carbon metabolism in cancer
    100062044 (TP53)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100062044 (TP53)
   05212 Pancreatic cancer
    100062044 (TP53)
   05225 Hepatocellular carcinoma
    100062044 (TP53)
   05226 Gastric cancer
    100062044 (TP53)
   05214 Glioma
    100062044 (TP53)
   05216 Thyroid cancer
    100062044 (TP53)
   05220 Chronic myeloid leukemia
    100062044 (TP53)
   05217 Basal cell carcinoma
    100062044 (TP53)
   05218 Melanoma
    100062044 (TP53)
   05219 Bladder cancer
    100062044 (TP53)
   05215 Prostate cancer
    100062044 (TP53)
   05213 Endometrial cancer
    100062044 (TP53)
   05224 Breast cancer
    100062044 (TP53)
   05222 Small cell lung cancer
    100062044 (TP53)
   05223 Non-small cell lung cancer
    100062044 (TP53)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    100062044 (TP53)
   05014 Amyotrophic lateral sclerosis
    100062044 (TP53)
   05016 Huntington disease
    100062044 (TP53)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100062044 (TP53)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100062044 (TP53)
   05161 Hepatitis B
    100062044 (TP53)
   05160 Hepatitis C
    100062044 (TP53)
   05162 Measles
    100062044 (TP53)
   05168 Herpes simplex virus 1 infection
    100062044 (TP53)
   05163 Human cytomegalovirus infection
    100062044 (TP53)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100062044 (TP53)
   05169 Epstein-Barr virus infection
    100062044 (TP53)
   05165 Human papillomavirus infection
    100062044 (TP53)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100062044 (TP53)
   01522 Endocrine resistance
    100062044 (TP53)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ecb03000]
    100062044 (TP53)
   03036 Chromosome and associated proteins [BR:ecb03036]
    100062044 (TP53)
   03400 DNA repair and recombination proteins [BR:ecb03400]
    100062044 (TP53)
Transcription factors [BR:ecb03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   p53
    100062044 (TP53)
Chromosome and associated proteins [BR:ecb03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     100062044 (TP53)
DNA repair and recombination proteins [BR:ecb03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    100062044 (TP53)
SSDB
Motif
Pfam: P53 P53_tetramer P53_TAD CEP1-DNA_bind
Other DBs
NCBI-GeneID: 100062044
NCBI-ProteinID: NP_001189334
UniProt: E9NME8
LinkDB
Position
11
AA seq 381 aa
MEETQTELGIEPPLSQETFSDLWKLLPENNVLSPDLSPAVNNLLLSPDVVNWLDEGPDEA
PRMPAAPAPLAPAPATSWPLSSFVPSQKTYPGCYGFRLGFLNSGTAKSVTCTYSPTLNKL
FCQLAKTCPVQLLVSSPPPPGTRVRAMAIYKKSEFMTEVVRRCPHHERCSDSSDGLAPPQ
HLIRVEGNLRAEYLEDRNTFRHSVVVPYEPPEVGSDCTTIHYNFMCNSSCMGGMNRRPIL
TIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENFRKKEEPCPEPPPRSTKRVLSSNT
SSSPPQKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQTGKEPGGSKAHSSHLKSK
KGQSTSSHKKLIFKREGPDSD
NT seq 1146 nt   +upstreamnt  +downstreamnt
atggaggagacgcagacagaactcggcatcgagccccctctgagtcaggagacgttttca
gatttgtggaagctacttcctgaaaacaatgttctgtcccctgacctgtccccagcagtg
aataatctgctgctgtccccagatgttgtgaactggctggatgaaggcccagatgaagcc
cccagaatgccagcagctcctgcaccactagcccctgcaccagccacctcctggcccctg
tcatcctttgtcccttcccaaaagacctaccctggctgctatggtttccgtttagggttc
ctgaattctgggacagccaagtctgttacttgcacgtactcccctaccctcaacaaactg
ttttgccagctggcaaagacctgccccgtgcagctcctggtcagctcaccacccccaccc
ggcacccgtgtccgggccatggccatctacaagaagtcagagttcatgacggaggtcgtg
aggcgctgcccccaccatgaacgctgctctgacagtagcgatggtctggcccctcctcag
catctcatccgggtggaagggaatctgcgtgctgagtatttggaagacagaaacactttt
cgacatagcgtggtggtgccctacgagccacctgaggttggctctgactgtaccaccatc
cactacaacttcatgtgtaacagctcctgcatgggcggcatgaaccggcggcccatcctc
actatcatcaccctggaagactccagtggtaatctgctgggacggaacagctttgaggtg
cgtgtttgtgcctgtcctgggagagaccggcgcacagaggaagaaaacttccgcaagaag
gaggaaccttgccctgagccgcctcctaggagcactaagcgagtattgtccagtaacacc
agctcctctcccccacaaaagaagaagccactggatggagaatatttcacccttcagatc
cgtgggcgtgaacgttttgagatgttccgagagctgaatgaggccttggagctgaaagat
gcccagactggaaaggagccagggggaagcaaggctcactccagccacctgaagtctaag
aaggggcagtctacctcctcccataaaaagctgatattcaagagagaagggcctgactca
gactga

DBGET integrated database retrieval system