KEGG   Equus caballus (horse): 100062208Help
Entry
100062208         CDS       T01058                                 

Gene name
HDAC6
Definition
(RefSeq) histone deacetylase 6 isoform X1
  KO
K11407  histone deacetylase 6 [EC:3.5.1.98]
Organism
ecb  Equus caballus (horse)
Pathway
ecb05034  Alcoholism
ecb05165  Human papillomavirus infection
ecb05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09160 Human Diseases
  09161 Cancers
   05203 Viral carcinogenesis
    100062208 (HDAC6)
  09164 Substance dependence
   05034 Alcoholism
    100062208 (HDAC6)
  09167 Infectious diseases
   05165 Human papillomavirus infection
    100062208 (HDAC6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatase and associated proteins [BR:ecb01009]
    100062208 (HDAC6)
  09182 Protein families: genetic information processing
   03019 Messenger RNA Biogenesis [BR:ecb03019]
    100062208 (HDAC6)
   04131 Membrane trafficking [BR:ecb04131]
    100062208 (HDAC6)
   03036 Chromosome and associated proteins [BR:ecb03036]
    100062208 (HDAC6)
Enzymes [BR:ecb01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     100062208 (HDAC6)
Protein phosphatases and associated proteins [BR:ecb01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100062208 (HDAC6)
Messenger RNA biogenesis [BR:ecb03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     100062208 (HDAC6)
Membrane trafficking [BR:ecb04131]
 Autophagy
  Aggrephagy
   Other aggrephagy associated proteins
    100062208 (HDAC6)
Chromosome and associated proteins [BR:ecb03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     100062208 (HDAC6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl zf-UBP
Motif
Other DBs
NCBI-GeneID: 100062208
NCBI-ProteinID: XP_005614176
Ensembl: ENSECAG00000000227
VGNC: 50595
LinkDB All DBs
Position
X
AA seq 1229 aa AA seqDB search
MEKKTSGTRGATGRREFGGGSQGRSLRKGLRSNVVRGEASPTMTSTGQDSTTTRQRRSRH
NPHSPPHDSSVASKRSVKKGATLRSSPNLAEVKKKGRMKKLSQAADQDLIMGLQGLDLNL
EAKTLSGTGLVFDEQLNEFHCLWDDSFPEGPERLHAIKEQLIQEGLLDRCVSFQARFAEK
EELMLVHSLEYIDLMETTQYMNERELRILADTYDSVYLHPNSYTCACLASGSVLRLVDAV
LGAEIRNGMAIIRPPGHHAQHSLMDGYCMFNHVAVAARYAQQKHEIQRILIVDWDVHHGQ
GTQFTFDQDPSVLYFSIHRYEQGRFWPHLKASDWSTIGFGQGRGYTINVPWNQVGMRDAD
YIAAFLHILLPVALEFQPQLVLVAAGFDALQGDPKGEMAATPAGFAHLTHLLMGLAGGKL
ILSLEGGYNLRSLAEGVSASLHTLLGDPCPMLESPGAPCLSAKASLSCTLEALEPFWEVL
VRSVETMEEDIVEGDNVEEKEEGPWQPPALPILTWPVLQARTGLVYDQRMMGHYNLWDSH
HPEMPQRVSRIMRRLEELHLAERCLTLPARPATDAELLTCHSAEYVGRLRATEKMKTREL
HREGANFDSIYICPSTFACAQLATGAVCRLVEAVLAGEVLNGIAVVRPPGHHAEQDAACG
FCFFNSVAVAARHAQAISGHALRILIVDWDVHHGNGTQHIFEEDPSVLYISLHRYDHGTF
FPLGDEGASSQMGQAAGTGFTVNVTWNGPRMGDADYLAAWHRLVLPIAYEFNPELVLVSA
GFDAARGDPLGGCQVSPEGYAHLTHLLMGLANGHIILILEGGYNLTSISESMAACTRSLL
GDPPPLLTLTRPPLAGALASITETIQVHRRYWRSLQITKVEDKEGPSSSLLITKKAPQPA
NPGSAKEMITPEGNILDAGRGKATSVSSVEESTAGQTKSETAVVELTQDKSLEAATEEAT
LDQTTSETATGEATLDQTTSEIATGEAKLDQATSETAMGGATLDQTTLGATPGVTTLDQT
TSEAVRGAELIQVPPASSTDNQTPPASPVEGDPPHISPSKLIGNLRTLELDNEAQEAPES
QSPEEERLLGEATGGQDMDDLVLMQSFGDNADTDQAMFYAVTPLPWCPHLVAVSPVPDTG
LDVTQPCQDCGALQENWVCLSCHQVYCGRYINAHMLQHHEGSGHPLVLSYVDLSTWCYYC
QAYVHHQALLDAKNVAHQNKFGEGMPHSH
NT seq 3690 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagaagacctcgggcacccgcggcgccacaggtcgccgggaatttggcggcggg
agccaagggcggagtttgagaaaggggctgcgctcaaacgtcgtcaggggtgaagcctcc
ccgaccatgacctctaccggccaggattccaccacaaccaggcagcgaaggagtaggcac
aacccccactcccccccccacgactccagcgtcgcctcgaagaggagtgttaagaagggt
gccacactccgctccagccctaatctagcggaggtaaagaagaaaggcagaatgaagaag
ctcagccaagcagccgaccaagacctaatcatggggctgcaagggctggatctgaacctt
gaggccaagacgctgtctggcactggcttggtgtttgatgagcagctaaatgaatttcat
tgcctctgggatgacagcttccctgaaggccctgagcggctccatgccatcaaggagcag
ctgatccaggagggcctcttggaccgctgtgtgtcctttcaggcccggttcgccgaaaag
gaggagctgatgttggttcacagcctagaatatattgatctgatggagacgacccaatac
atgaatgaaagggaactccgcatcctagcagacacctatgactcagtttatctgcatccg
aactcatacacctgtgcctgcctggcctcaggctctgtcctcaggctggtggatgctgtc
ctgggggccgagatccggaatggcatggccatcatcaggcctcctggacaccatgcccag
cacagtcttatggatgggtattgcatgttcaaccatgtggccgtggctgcccgctacgct
caacagaagcatgaaattcagaggatccttatcgtggattgggatgtacaccatggtcaa
ggaacacagttcacctttgaccaggaccccagcgtcctctatttctccatccaccgctat
gagcagggtcggttctggccccaccttaaggcctctgactggtccaccataggttttggc
caaggccggggatacaccatcaatgtgccttggaaccaggtgggcatgcgagatgccgac
tacattgctgctttcctgcacatcctgctgccagtcgccctggagttccagccacagcta
gtcctggtggctgctggatttgatgccctccaaggggaccccaagggtgagatggctgcc
actccagcagggttcgcccacctgacccacctgctcatgggtctggcaggaggcaagctg
atcctgtctctggagggtggctacaacctccgctctctggctgagggtgtcagcgcctcg
ctccacacccttctgggagatccttgccccatgctggaatcccctggtgccccctgcctg
agtgccaaggcatcactctcctgcactctggaagccctggagcccttctgggaggtcctt
gtgagatcagttgagaccatggaggaggacattgtggagggggacaacgtggaggagaaa
gaggagggaccatggcagccccctgcactcccaatcctgacgtggcctgtgctgcaggct
cgcaccgggctggtctatgaccagcggatgatgggtcactacaacttgtgggacagccat
caccccgagatgcctcagcgtgtctcacggatcatgcgccgtctggaggagctgcacctt
gccgagcgctgccttaccctgcccgcacgtcccgccacagatgctgagcttcttacctgc
cacagtgctgaatatgtgggtcgtctacgggccacggagaagatgaaaacccgggagctg
caccgtgagggcgccaactttgactccatctacatctgccccagcaccttcgcctgcgcg
cagctggccactggcgctgtgtgccgcctggtggaggctgtgctggcgggagaggttttg
aatggtattgctgtggtgcgtcccccgggacaccacgcagagcaggatgccgcttgtggt
ttctgctttttcaactctgtagctgtggctgctcgccatgcccaggccatcagtgggcat
gcgctgcggatcctgatcgtagactgggacgtccatcacggtaatggaactcagcacata
tttgaggaggaccccagcgtgctgtacatttccctgcaccgctatgatcacggtaccttc
ttccccctgggggatgagggcgccagcagccagatgggccaggctgcaggcacaggcttc
actgtcaatgtgacctggaacgggccccgcatgggtgacgctgactacctggctgcctgg
catcgcctggtgcttcccattgcctatgagtttaacccagaactggtgctagtctcagct
ggctttgacgctgcacggggtgacccactgggtggttgccaggtgtcgcctgagggctat
gcccaccttacccacctgctgatgggccttgccaatggccacattatcctaatcctagag
ggtggctataatctgacatccatctcagagtccatggccgcttgcacccgctccctcctt
ggggacccaccacctctgctgaccctgacacggcccccactagcaggggccctggcctcc
atcactgagaccatccaagtccatcgcagatactggcgcagcttgcagatcacaaaggtc
gaagacaaggagggaccatccagttctttgttgatcaccaagaaggcaccccaaccagcc
aatcctgggtcagccaaggagatgatcacaccagaagggaacattctggatgcaggcagg
gggaaggccacctcagtatcatctgtagaagagtctactgcaggccagactaagtcagag
acagctgtggtggagctcactcaggacaagtccttggaggcagccacagaggaagccacg
ctggaccagaccacctcagagacagccacaggggaagccacgctggaccagaccacctca
gagatagccacgggggaagccaagctagaccaggccacctcagagacagccatgggggga
gccacgctggaccagaccaccttgggggcaaccccaggagtaaccacgctggatcagacc
acctcagaggctgtcaggggagctgagctgatccaagtccctccagcctcaagcactgac
aaccagactcccccagcctcacctgtggaaggagacccaccccacatatcccctagtaag
ctgattgggaatctcaggaccttggaactagacaacgaggctcaggaggcaccagaatct
cagagccctgaagaggagagactactaggagaggcaactggaggtcaagacatggatgat
ttagtgctgatgcagagctttggggacaatgctgacactgaccaggccatgttttatgcc
gtgacaccactgccctggtgtcctcatttggtggcagtaagccccgtacctgacacaggc
ctggacgtgacccaaccttgtcaggactgtggagcactccaggagaactgggtgtgtctg
tcttgccatcaggtctactgtggtcgttacatcaatgcccatatgctccaacaccatgaa
ggctcaggacaccctctggtcctcagctacgtcgacctgtctacctggtgttactactgt
caggcttatgtccaccaccaggctctcctagatgcgaagaacgtcgcccaccagaacaag
tttggggagggcatgccccactcacactaa

DBGET integrated database retrieval system