KEGG   Equus caballus (horse): 100062536
Entry
100062536         CDS       T01058                                 

Gene name
MAX
Definition
(RefSeq) protein max isoform X2
  KO
K04453  Max protein
Organism
ecb  Equus caballus (horse)
Pathway
ecb04010  MAPK signaling pathway
ecb05200  Pathways in cancer
ecb05202  Transcriptional misregulation in cancer
ecb05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100062536 (MAX)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100062536 (MAX)
   05202 Transcriptional misregulation in cancer
    100062536 (MAX)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100062536 (MAX)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ecb03000]
    100062536 (MAX)
Transcription factors [BR:ecb03000]
 Eukaryotic type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Cell cycle controlling factors, Mad/Max
    100062536 (MAX)
SSDB
Motif
Pfam: HLH Filament Jnk-SapK_ap_N DUF5716 SlyX bZIP_2 DUF5595 ZapB ATG16 DUF4763 Csm1_N V_ATPase_I
Other DBs
NCBI-GeneID: 100062536
NCBI-ProteinID: XP_001494116
Ensembl: ENSECAG00000006923
VGNC: 20002
LinkDB
Position
24
AA seq 160 aa
MSDNDDIEVESDEEQPRFQSAADKRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEKASR
AQILDKATEYIQYMRRKNHTHQQDIDDLKRQNALLEQQVRALEKARSSAQLQTNYPSSDN
SLYTNAKGGTISAFDGGSDSSSESEPEEPQSRKKVRMEAS
NT seq 483 nt   +upstreamnt  +downstreamnt
atgagcgataacgatgacatcgaggtggagagcgacgaagagcaaccgaggtttcaatct
gcggctgacaaacgggctcatcataatgcactggaacgaaaacgcagggaccacatcaaa
gacagctttcacagtctgcgggactcggtcccctccctccagggagagaaggcatcccgg
gcccaaatcctagacaaagccacagagtatatccagtatatgcgaaggaaaaaccacaca
caccagcaagatattgatgacctcaagcggcagaatgctcttctggagcagcaagtccgt
gcactggagaaggcgaggtcgagtgcccaactgcagaccaactacccctcctcagacaac
agcctctacaccaacgccaagggcggcaccatctctgccttcgatgggggctcggactcc
agctcggagtcggagcccgaagagccccagagcaggaagaaggtccggatggaggccagc
tag

DBGET integrated database retrieval system