KEGG   Equus caballus (horse): 100062549
Entry
100062549         CDS       T01058                                 

Gene name
PRKCG
Definition
(RefSeq) protein kinase C gamma type
  KO
K19663  classical protein kinase C gamma type [EC:2.7.11.13]
Organism
ecb  Equus caballus (horse)
Pathway
ecb01521  EGFR tyrosine kinase inhibitor resistance
ecb04010  MAPK signaling pathway
ecb04012  ErbB signaling pathway
ecb04014  Ras signaling pathway
ecb04015  Rap1 signaling pathway
ecb04020  Calcium signaling pathway
ecb04066  HIF-1 signaling pathway
ecb04070  Phosphatidylinositol signaling system
ecb04071  Sphingolipid signaling pathway
ecb04150  mTOR signaling pathway
ecb04270  Vascular smooth muscle contraction
ecb04310  Wnt signaling pathway
ecb04370  VEGF signaling pathway
ecb04510  Focal adhesion
ecb04540  Gap junction
ecb04613  Neutrophil extracellular trap formation
ecb04650  Natural killer cell mediated cytotoxicity
ecb04666  Fc gamma R-mediated phagocytosis
ecb04670  Leukocyte transendothelial migration
ecb04713  Circadian entrainment
ecb04720  Long-term potentiation
ecb04723  Retrograde endocannabinoid signaling
ecb04724  Glutamatergic synapse
ecb04725  Cholinergic synapse
ecb04726  Serotonergic synapse
ecb04727  GABAergic synapse
ecb04728  Dopaminergic synapse
ecb04730  Long-term depression
ecb04750  Inflammatory mediator regulation of TRP channels
ecb04911  Insulin secretion
ecb04916  Melanogenesis
ecb04918  Thyroid hormone synthesis
ecb04919  Thyroid hormone signaling pathway
ecb04921  Oxytocin signaling pathway
ecb04925  Aldosterone synthesis and secretion
ecb04928  Parathyroid hormone synthesis, secretion and action
ecb04929  GnRH secretion
ecb04935  Growth hormone synthesis, secretion and action
ecb04960  Aldosterone-regulated sodium reabsorption
ecb04961  Endocrine and other factor-regulated calcium reabsorption
ecb04970  Salivary secretion
ecb04971  Gastric acid secretion
ecb04972  Pancreatic secretion
ecb05017  Spinocerebellar ataxia
ecb05022  Pathways of neurodegeneration - multiple diseases
ecb05031  Amphetamine addiction
ecb05032  Morphine addiction
ecb05143  African trypanosomiasis
ecb05146  Amoebiasis
ecb05161  Hepatitis B
ecb05163  Human cytomegalovirus infection
ecb05170  Human immunodeficiency virus 1 infection
ecb05171  Coronavirus disease - COVID-19
ecb05200  Pathways in cancer
ecb05205  Proteoglycans in cancer
ecb05206  MicroRNAs in cancer
ecb05214  Glioma
ecb05223  Non-small cell lung cancer
ecb05225  Hepatocellular carcinoma
ecb05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100062549 (PRKCG)
   04012 ErbB signaling pathway
    100062549 (PRKCG)
   04014 Ras signaling pathway
    100062549 (PRKCG)
   04015 Rap1 signaling pathway
    100062549 (PRKCG)
   04310 Wnt signaling pathway
    100062549 (PRKCG)
   04370 VEGF signaling pathway
    100062549 (PRKCG)
   04066 HIF-1 signaling pathway
    100062549 (PRKCG)
   04020 Calcium signaling pathway
    100062549 (PRKCG)
   04070 Phosphatidylinositol signaling system
    100062549 (PRKCG)
   04071 Sphingolipid signaling pathway
    100062549 (PRKCG)
   04150 mTOR signaling pathway
    100062549 (PRKCG)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100062549 (PRKCG)
   04540 Gap junction
    100062549 (PRKCG)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    100062549 (PRKCG)
   04650 Natural killer cell mediated cytotoxicity
    100062549 (PRKCG)
   04666 Fc gamma R-mediated phagocytosis
    100062549 (PRKCG)
   04670 Leukocyte transendothelial migration
    100062549 (PRKCG)
  09152 Endocrine system
   04911 Insulin secretion
    100062549 (PRKCG)
   04929 GnRH secretion
    100062549 (PRKCG)
   04921 Oxytocin signaling pathway
    100062549 (PRKCG)
   04935 Growth hormone synthesis, secretion and action
    100062549 (PRKCG)
   04918 Thyroid hormone synthesis
    100062549 (PRKCG)
   04919 Thyroid hormone signaling pathway
    100062549 (PRKCG)
   04928 Parathyroid hormone synthesis, secretion and action
    100062549 (PRKCG)
   04916 Melanogenesis
    100062549 (PRKCG)
   04925 Aldosterone synthesis and secretion
    100062549 (PRKCG)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100062549 (PRKCG)
  09154 Digestive system
   04970 Salivary secretion
    100062549 (PRKCG)
   04971 Gastric acid secretion
    100062549 (PRKCG)
   04972 Pancreatic secretion
    100062549 (PRKCG)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100062549 (PRKCG)
   04961 Endocrine and other factor-regulated calcium reabsorption
    100062549 (PRKCG)
  09156 Nervous system
   04724 Glutamatergic synapse
    100062549 (PRKCG)
   04727 GABAergic synapse
    100062549 (PRKCG)
   04725 Cholinergic synapse
    100062549 (PRKCG)
   04728 Dopaminergic synapse
    100062549 (PRKCG)
   04726 Serotonergic synapse
    100062549 (PRKCG)
   04720 Long-term potentiation
    100062549 (PRKCG)
   04730 Long-term depression
    100062549 (PRKCG)
   04723 Retrograde endocannabinoid signaling
    100062549 (PRKCG)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100062549 (PRKCG)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100062549 (PRKCG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100062549 (PRKCG)
   05206 MicroRNAs in cancer
    100062549 (PRKCG)
   05205 Proteoglycans in cancer
    100062549 (PRKCG)
   05231 Choline metabolism in cancer
    100062549 (PRKCG)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100062549 (PRKCG)
   05214 Glioma
    100062549 (PRKCG)
   05223 Non-small cell lung cancer
    100062549 (PRKCG)
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    100062549 (PRKCG)
   05022 Pathways of neurodegeneration - multiple diseases
    100062549 (PRKCG)
  09165 Substance dependence
   05031 Amphetamine addiction
    100062549 (PRKCG)
   05032 Morphine addiction
    100062549 (PRKCG)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100062549 (PRKCG)
   05161 Hepatitis B
    100062549 (PRKCG)
   05171 Coronavirus disease - COVID-19
    100062549 (PRKCG)
   05163 Human cytomegalovirus infection
    100062549 (PRKCG)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100062549 (PRKCG)
   05143 African trypanosomiasis
    100062549 (PRKCG)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100062549 (PRKCG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ecb01001]
    100062549 (PRKCG)
Enzymes [BR:ecb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     100062549 (PRKCG)
Protein kinases [BR:ecb01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   100062549 (PRKCG)
SSDB
Motif
Pfam: Pkinase C1_1 PK_Tyr_Ser-Thr C2 Pkinase_C Kinase-like
Other DBs
NCBI-GeneID: 100062549
NCBI-ProteinID: XP_001493745
Ensembl: ENSECAG00000019249
VGNC: 21845
UniProt: F7CH66
LinkDB
Position
10
AA seq 697 aa
MSGLGPGGGDSEGGPRPLFCRKGALRQKVVHEVKSHKFTARFFKQPTFCSHCTDFIWGIG
KQGLQCQVCSFVVHRRCHEFVTFECPGAGKGPQTDDPRNKHKFRLHSYSSPTFCDHCGSL
LYGLVHQGMKCSCCEMNVHRRCVRSVPSLCGVDHTERRGRLQLEIRAPTADEIHVTVGEA
RNLIPMDPNGLSDPYVKLKLIPDPRNLTKQKTRTVKATLNPVWNETFVFNLKPGDVERRL
SVEVWDWDRTSRNDFMGAMSFGVSELLKAPVDGWYKLLNQEEGEYYNVPVADADNCSLLQ
KFEACNYPLELYERVRMGPSSSPIPSPSPSPTDSKRCFFGASPGRLHISDFSFLMVLGKG
SFGKVMLAERRGSDELYAIKILKKDVIVQDDDVDCTLVEKRVLALGGRGPGGRPHFLTQL
HSTFQTPDRLYFVMEYVTGGDLMYHIQQLGKFKEPHAAFYAAEIAIGLFFLHNQGIIYRD
LKLDNVMLDAEGHIKITDFGMCKENVFPGTTTRTFCGTPDYIAPEIIAYQPYGKSVDWWS
FGVLLYEMLAGQPPFDGEDEEELFQAIMEQTVTYPKSLSREAVAICKGFLTKHPAKRLGS
GPDGEPTIRAHGFFRWIDWERLERLEIAPPFRPRPCGRSGENFDKFFTRAAPALTPPDRL
VLASIDQADFQGFTYVNPDFVHPDARSPISPTPVPVM
NT seq 2094 nt   +upstreamnt  +downstreamnt
atgtcaggcctcggccctggcggaggcgattcggaggggggaccccgacccctgttttgc
agaaagggggctctgaggcagaaggtggtccacgaagtcaagagccacaagttcaccgct
cgcttcttcaagcagccaaccttctgcagccactgcaccgacttcatctggggcattgga
aaacagggcctgcaatgtcaagtctgcagctttgtggttcatcgacgatgccacgaattt
gtgaccttcgagtgtccaggcgctgggaagggcccccagacggacgatccccggaacaag
cacaagttccgtctgcacagctacagcagccccaccttctgcgaccactgtggctccctg
ctttacgggctggtgcaccagggcatgaaatgctcctgctgcgagatgaacgtgcaccgg
cgctgtgtgcgcagcgtgccctctctgtgcggcgtggaccacacggagcgccgcgggcgc
ctgcagctggaaatccgggctccgactgccgatgagattcacgtcacggttggtgaggcc
cgtaacctcatccccatggaccccaatggtctgtctgatccctatgtgaaactgaagctc
atcccagaccctcggaacttgacaaaacagaagacccggacggtgaaagccacgctaaac
cccgtgtggaacgagacctttgtgttcaacctgaagccgggggatgtggagcgcaggctc
agcgtcgaggtgtgggactgggaccggacttcccgcaacgacttcatgggtgccatgtcc
ttcggcgtctcggagctgctcaaggcgccggtggacggctggtacaagttactgaaccag
gaggagggcgaatattacaatgtgccggtggctgatgctgacaactgcagcctcctccag
aagtttgaggcctgtaactaccccctggaactgtatgagcgggtgcggatggggccgtcc
tcctctcccatcccctccccatcccctagtcccacggactccaagcgctgtttcttcggg
gcaagccctggacgtctgcacatctctgacttcagcttcctcatggttctaggaaaaggc
agttttgggaaggtgatgctggctgagcgcaggggctctgatgagctctacgccatcaag
atcctgaagaaagacgtgatcgtccaggatgacgacgtggactgcaccctggtggaaaaa
cgcgtgctggccctcgggggccgaggcccgggaggccggccccactttctcacccagctc
cactccaccttccagaccccggatcgcctgtattttgtgatggagtatgtcaccgggggc
gacttgatgtaccacatccagcagttgggcaagtttaaggagccccacgcggcgttctat
gcagcggaaattgccatcggcctcttcttccttcacaatcagggcatcatttaccgggac
ctgaaactggacaacgtgatgctggatgccgaaggacatatcaaaatcactgactttggc
atgtgtaaggagaatgtcttccccgggaccaccacccgcaccttctgcgggaccccagac
tacatagcccccgagatcattgcctaccagccctatgggaagtctgtggattggtggtcc
tttggggttctgttgtatgagatgttggcgggacagccccccttcgatggggaggatgag
gaggagctgtttcaggccatcatggaacaaactgtcacctaccccaagtcgctttcccgg
gaagccgtggccatctgcaaggggttcctaaccaagcaccccgccaagcgcctgggctca
ggcccagacggggaacccaccatccgtgctcacggctttttccgctggatcgactgggag
cggctggaacgattggagatcgcgcctccattcagaccccgcccgtgcggccgcagcggg
gagaacttcgacaagttcttcacacgggccgcgccagcgctgacccctccagaccgccta
gttctggccagcatcgaccaggcagatttccaaggcttcacctacgttaacccggatttt
gtgcacccggatgcgcgcagccccatcagcccgacgccggtgccagtcatgtaa

KEGG   Equus caballus (horse): 100063318
Entry
100063318         CDS       T01058                                 

Gene name
PRKCA
Definition
(RefSeq) protein kinase C alpha type isoform X1
  KO
K02677  classical protein kinase C alpha type [EC:2.7.11.13]
Organism
ecb  Equus caballus (horse)
Pathway
ecb01521  EGFR tyrosine kinase inhibitor resistance
ecb04010  MAPK signaling pathway
ecb04012  ErbB signaling pathway
ecb04014  Ras signaling pathway
ecb04015  Rap1 signaling pathway
ecb04020  Calcium signaling pathway
ecb04066  HIF-1 signaling pathway
ecb04070  Phosphatidylinositol signaling system
ecb04071  Sphingolipid signaling pathway
ecb04072  Phospholipase D signaling pathway
ecb04150  mTOR signaling pathway
ecb04151  PI3K-Akt signaling pathway
ecb04261  Adrenergic signaling in cardiomyocytes
ecb04270  Vascular smooth muscle contraction
ecb04310  Wnt signaling pathway
ecb04360  Axon guidance
ecb04370  VEGF signaling pathway
ecb04510  Focal adhesion
ecb04540  Gap junction
ecb04613  Neutrophil extracellular trap formation
ecb04650  Natural killer cell mediated cytotoxicity
ecb04664  Fc epsilon RI signaling pathway
ecb04666  Fc gamma R-mediated phagocytosis
ecb04670  Leukocyte transendothelial migration
ecb04713  Circadian entrainment
ecb04720  Long-term potentiation
ecb04723  Retrograde endocannabinoid signaling
ecb04724  Glutamatergic synapse
ecb04725  Cholinergic synapse
ecb04726  Serotonergic synapse
ecb04727  GABAergic synapse
ecb04728  Dopaminergic synapse
ecb04730  Long-term depression
ecb04750  Inflammatory mediator regulation of TRP channels
ecb04911  Insulin secretion
ecb04912  GnRH signaling pathway
ecb04916  Melanogenesis
ecb04918  Thyroid hormone synthesis
ecb04919  Thyroid hormone signaling pathway
ecb04921  Oxytocin signaling pathway
ecb04925  Aldosterone synthesis and secretion
ecb04926  Relaxin signaling pathway
ecb04928  Parathyroid hormone synthesis, secretion and action
ecb04929  GnRH secretion
ecb04933  AGE-RAGE signaling pathway in diabetic complications
ecb04935  Growth hormone synthesis, secretion and action
ecb04960  Aldosterone-regulated sodium reabsorption
ecb04961  Endocrine and other factor-regulated calcium reabsorption
ecb04970  Salivary secretion
ecb04971  Gastric acid secretion
ecb04972  Pancreatic secretion
ecb05017  Spinocerebellar ataxia
ecb05022  Pathways of neurodegeneration - multiple diseases
ecb05031  Amphetamine addiction
ecb05032  Morphine addiction
ecb05143  African trypanosomiasis
ecb05146  Amoebiasis
ecb05161  Hepatitis B
ecb05163  Human cytomegalovirus infection
ecb05164  Influenza A
ecb05170  Human immunodeficiency virus 1 infection
ecb05171  Coronavirus disease - COVID-19
ecb05200  Pathways in cancer
ecb05205  Proteoglycans in cancer
ecb05206  MicroRNAs in cancer
ecb05214  Glioma
ecb05223  Non-small cell lung cancer
ecb05225  Hepatocellular carcinoma
ecb05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100063318 (PRKCA)
   04012 ErbB signaling pathway
    100063318 (PRKCA)
   04014 Ras signaling pathway
    100063318 (PRKCA)
   04015 Rap1 signaling pathway
    100063318 (PRKCA)
   04310 Wnt signaling pathway
    100063318 (PRKCA)
   04370 VEGF signaling pathway
    100063318 (PRKCA)
   04066 HIF-1 signaling pathway
    100063318 (PRKCA)
   04020 Calcium signaling pathway
    100063318 (PRKCA)
   04070 Phosphatidylinositol signaling system
    100063318 (PRKCA)
   04072 Phospholipase D signaling pathway
    100063318 (PRKCA)
   04071 Sphingolipid signaling pathway
    100063318 (PRKCA)
   04151 PI3K-Akt signaling pathway
    100063318 (PRKCA)
   04150 mTOR signaling pathway
    100063318 (PRKCA)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100063318 (PRKCA)
   04540 Gap junction
    100063318 (PRKCA)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    100063318 (PRKCA)
   04650 Natural killer cell mediated cytotoxicity
    100063318 (PRKCA)
   04664 Fc epsilon RI signaling pathway
    100063318 (PRKCA)
   04666 Fc gamma R-mediated phagocytosis
    100063318 (PRKCA)
   04670 Leukocyte transendothelial migration
    100063318 (PRKCA)
  09152 Endocrine system
   04911 Insulin secretion
    100063318 (PRKCA)
   04929 GnRH secretion
    100063318 (PRKCA)
   04912 GnRH signaling pathway
    100063318 (PRKCA)
   04921 Oxytocin signaling pathway
    100063318 (PRKCA)
   04926 Relaxin signaling pathway
    100063318 (PRKCA)
   04935 Growth hormone synthesis, secretion and action
    100063318 (PRKCA)
   04918 Thyroid hormone synthesis
    100063318 (PRKCA)
   04919 Thyroid hormone signaling pathway
    100063318 (PRKCA)
   04928 Parathyroid hormone synthesis, secretion and action
    100063318 (PRKCA)
   04916 Melanogenesis
    100063318 (PRKCA)
   04925 Aldosterone synthesis and secretion
    100063318 (PRKCA)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100063318 (PRKCA)
   04270 Vascular smooth muscle contraction
    100063318 (PRKCA)
  09154 Digestive system
   04970 Salivary secretion
    100063318 (PRKCA)
   04971 Gastric acid secretion
    100063318 (PRKCA)
   04972 Pancreatic secretion
    100063318 (PRKCA)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100063318 (PRKCA)
   04961 Endocrine and other factor-regulated calcium reabsorption
    100063318 (PRKCA)
  09156 Nervous system
   04724 Glutamatergic synapse
    100063318 (PRKCA)
   04727 GABAergic synapse
    100063318 (PRKCA)
   04725 Cholinergic synapse
    100063318 (PRKCA)
   04728 Dopaminergic synapse
    100063318 (PRKCA)
   04726 Serotonergic synapse
    100063318 (PRKCA)
   04720 Long-term potentiation
    100063318 (PRKCA)
   04730 Long-term depression
    100063318 (PRKCA)
   04723 Retrograde endocannabinoid signaling
    100063318 (PRKCA)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100063318 (PRKCA)
  09158 Development and regeneration
   04360 Axon guidance
    100063318 (PRKCA)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100063318 (PRKCA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100063318 (PRKCA)
   05206 MicroRNAs in cancer
    100063318 (PRKCA)
   05205 Proteoglycans in cancer
    100063318 (PRKCA)
   05231 Choline metabolism in cancer
    100063318 (PRKCA)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100063318 (PRKCA)
   05214 Glioma
    100063318 (PRKCA)
   05223 Non-small cell lung cancer
    100063318 (PRKCA)
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    100063318 (PRKCA)
   05022 Pathways of neurodegeneration - multiple diseases
    100063318 (PRKCA)
  09165 Substance dependence
   05031 Amphetamine addiction
    100063318 (PRKCA)
   05032 Morphine addiction
    100063318 (PRKCA)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100063318 (PRKCA)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100063318 (PRKCA)
   05161 Hepatitis B
    100063318 (PRKCA)
   05171 Coronavirus disease - COVID-19
    100063318 (PRKCA)
   05164 Influenza A
    100063318 (PRKCA)
   05163 Human cytomegalovirus infection
    100063318 (PRKCA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100063318 (PRKCA)
   05143 African trypanosomiasis
    100063318 (PRKCA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100063318 (PRKCA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ecb01001]
    100063318 (PRKCA)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ecb04131]
    100063318 (PRKCA)
Enzymes [BR:ecb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     100063318 (PRKCA)
Protein kinases [BR:ecb01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   100063318 (PRKCA)
Membrane trafficking [BR:ecb04131]
 Endocytosis
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    100063318 (PRKCA)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C2 C1_1 Pkinase_C
Other DBs
NCBI-GeneID: 100063318
NCBI-ProteinID: XP_023507944
Ensembl: ENSECAG00000006771
VGNC: 21843
LinkDB
Position
11
AA seq 706 aa
MADVFPANDSTASQDVANRFARKGALRQKNVHEVKDHKFIARFFKQPTFCSHCTDFIWGF
GKQGFQCQVFICRKGFIKTDIIHSITVCCFVVHKRCHEFVTFSCPGADKGPDTDDPRSKH
KFKIHTYGSPTFCDHCGSLLYGLIHQGMKCDTCDMNVHKQCVINVPSLCGMDHTEKRGRI
YLKAEVADEKLHVTVRDAKNLIPMDPNGLSDPYVKLKLIPDPKNESKQKTKTIRSTLNPQ
WNESFTFKLKPSDKDRRLSVEIWDWDRTTRNDFMGSLSFGVSELMKMPASGWYKLLNQEE
GEYYNVPIPEGDEEGNMELRQKFEKAKLGPAGNKVISPSEDRRQPSNNLDRVKLTDFNFL
MVLGKGSFGKVMLADRKGTEELYAIKILKKDVVIQDDDVECTMVEKRVLALLDKPPFLTQ
LHSCFQTVDRLYFVMEYVNGGDLMYHIQQVGKFKEPQAVFYAAEISIGLFFLHKRGIIYR
DLKLDNVMLDSEGHIKIADFGMCKEHMMDGVTTRTFCGTPDYIAPEIIAYQPYGKSVDWW
AYGVLLYEMLAGQPPFDGEDEDELFQSIMEHNVSYPKSLSKEAVSICKGLMTKHPGKRLG
CGPEGERDVREHAFFRRIDWEKLENREIQPPFKPKVTFCTKMHWLQWASRPSCGKGAENF
DKFFTRGQPVLTPPDQLVIANIDQSDFEGFSYVNPQFLHPILQSAV
NT seq 2121 nt   +upstreamnt  +downstreamnt
atggctgacgttttcccggccaacgactccacggcgtctcaggacgtggccaaccgcttc
gcccgcaaaggggcgctgagacagaagaacgtgcacgaggtgaaggaccacaaattcatc
gcccgcttcttcaagcagcccaccttctgcagccactgcaccgacttcatctgggggttt
gggaaacaaggcttccagtgccaagtttttatatgcagaaagggcttcattaaaactgac
atcattcattcaatcacagtttgctgctttgtggtccacaagaggtgccatgaatttgtt
actttttcttgtccgggtgcggataagggacccgacactgatgaccccaggagcaagcac
aagtttaaaatccacacttacggaagccccaccttctgtgatcactgtgggtcattgctg
tatggacttatccatcaagggatgaaatgtgacacctgtgatatgaatgtgcacaagcag
tgtgtgataaatgtccccagcctctgcgggatggaccacacagagaagagagggcggatc
tacctgaaggcggaggttgccgatgaaaagctccatgtcacagtacgagatgcaaaaaat
ctaattcctatggatccaaatgggctttcagatccttatgtgaagctgaaacttattcct
gatcccaagaatgaaagcaaacaaaaaaccaaaaccatccgctccacactaaacccccag
tggaatgagtcctttaccttcaaattaaaaccttcggacaaagaccgacgactctctgta
gaaatctgggactgggaccgaacaaccaggaatgacttcatgggctccctttcctttgga
gtttcggagctgatgaagatgccggccagtggatggtacaagttgctcaaccaagaagaa
ggtgagtactacaacgtacccattccagaaggggacgaagaaggaaacatggagctcagg
cagaaattcgagaaagccaagcttggccccgctggtaacaaagtgatcagtccttcagaa
gacaggcgacaaccttctaacaaccttgacagagtgaaactcaccgacttcaatttcctc
atggtgctggggaagggcagttttgggaaggtgatgcttgctgacaggaagggaacagaa
gagctgtatgctatcaaaatcctgaagaaggacgtggtgattcaagatgacgatgtggag
tgcaccatggtggaaaagcgagtcctggccctgcttgacaagcccccgttcctgacgcag
ctgcactcctgcttccagacggtggatcgactatacttcgtcatggaatacgtcaatggc
ggggacctcatgtaccacattcagcaagtaggaaaatttaaggaaccacaagcagtattc
tatgcggctgagatttccattggattgttctttcttcataaaagaggaatcatttatagg
gatctgaagttagacaatgtcatgctggattcggaaggacatatcaagattgctgatttt
gggatgtgcaaggaacacatgatggatggagtcacgaccaggaccttctgtgggactcca
gattatattgccccagagataatcgcttatcagccatatggaaaatccgtggactggtgg
gcctatggcgtcctattgtatgaaatgctggcagggcagcctccatttgatggcgaagat
gaagacgaactgtttcagtctataatggagcacaacgtttcttaccccaaatccttgtcc
aaggaggccgtttccatctgcaaaggactgatgaccaaacaccccggcaagcggctgggc
tgtgggcccgagggcgagagggacgtgcgagaacatgccttcttccggaggatcgactgg
gagaaactggagaacagggagatccagccgccattcaagcccaaagtgactttctgtacc
aaaatgcactggcttcagtgggcatccaggccttcgtgtggcaaaggagcagaaaacttc
gacaagttcttcacacgagggcaacccgtgttaacgccgcctgatcagctggtcattgct
aacatagatcagtctgattttgaagggttctcgtatgtcaacccccagtttctgcacccc
atcttacaaagcgcagtatga

KEGG   Equus caballus (horse): 100069215
Entry
100069215         CDS       T01058                                 

Gene name
PRKCB
Definition
(RefSeq) protein kinase C beta type isoform X1
  KO
K19662  classical protein kinase C beta type [EC:2.7.11.13]
Organism
ecb  Equus caballus (horse)
Pathway
ecb01521  EGFR tyrosine kinase inhibitor resistance
ecb04010  MAPK signaling pathway
ecb04012  ErbB signaling pathway
ecb04014  Ras signaling pathway
ecb04015  Rap1 signaling pathway
ecb04020  Calcium signaling pathway
ecb04062  Chemokine signaling pathway
ecb04064  NF-kappa B signaling pathway
ecb04066  HIF-1 signaling pathway
ecb04070  Phosphatidylinositol signaling system
ecb04071  Sphingolipid signaling pathway
ecb04150  mTOR signaling pathway
ecb04270  Vascular smooth muscle contraction
ecb04310  Wnt signaling pathway
ecb04370  VEGF signaling pathway
ecb04510  Focal adhesion
ecb04540  Gap junction
ecb04613  Neutrophil extracellular trap formation
ecb04650  Natural killer cell mediated cytotoxicity
ecb04662  B cell receptor signaling pathway
ecb04666  Fc gamma R-mediated phagocytosis
ecb04670  Leukocyte transendothelial migration
ecb04713  Circadian entrainment
ecb04720  Long-term potentiation
ecb04723  Retrograde endocannabinoid signaling
ecb04724  Glutamatergic synapse
ecb04725  Cholinergic synapse
ecb04726  Serotonergic synapse
ecb04727  GABAergic synapse
ecb04728  Dopaminergic synapse
ecb04730  Long-term depression
ecb04750  Inflammatory mediator regulation of TRP channels
ecb04911  Insulin secretion
ecb04912  GnRH signaling pathway
ecb04916  Melanogenesis
ecb04918  Thyroid hormone synthesis
ecb04919  Thyroid hormone signaling pathway
ecb04921  Oxytocin signaling pathway
ecb04925  Aldosterone synthesis and secretion
ecb04928  Parathyroid hormone synthesis, secretion and action
ecb04929  GnRH secretion
ecb04931  Insulin resistance
ecb04933  AGE-RAGE signaling pathway in diabetic complications
ecb04935  Growth hormone synthesis, secretion and action
ecb04960  Aldosterone-regulated sodium reabsorption
ecb04961  Endocrine and other factor-regulated calcium reabsorption
ecb04970  Salivary secretion
ecb04971  Gastric acid secretion
ecb04972  Pancreatic secretion
ecb04973  Carbohydrate digestion and absorption
ecb05017  Spinocerebellar ataxia
ecb05022  Pathways of neurodegeneration - multiple diseases
ecb05031  Amphetamine addiction
ecb05032  Morphine addiction
ecb05140  Leishmaniasis
ecb05143  African trypanosomiasis
ecb05146  Amoebiasis
ecb05161  Hepatitis B
ecb05163  Human cytomegalovirus infection
ecb05164  Influenza A
ecb05170  Human immunodeficiency virus 1 infection
ecb05171  Coronavirus disease - COVID-19
ecb05200  Pathways in cancer
ecb05205  Proteoglycans in cancer
ecb05206  MicroRNAs in cancer
ecb05214  Glioma
ecb05223  Non-small cell lung cancer
ecb05225  Hepatocellular carcinoma
ecb05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100069215 (PRKCB)
   04012 ErbB signaling pathway
    100069215 (PRKCB)
   04014 Ras signaling pathway
    100069215 (PRKCB)
   04015 Rap1 signaling pathway
    100069215 (PRKCB)
   04310 Wnt signaling pathway
    100069215 (PRKCB)
   04370 VEGF signaling pathway
    100069215 (PRKCB)
   04064 NF-kappa B signaling pathway
    100069215 (PRKCB)
   04066 HIF-1 signaling pathway
    100069215 (PRKCB)
   04020 Calcium signaling pathway
    100069215 (PRKCB)
   04070 Phosphatidylinositol signaling system
    100069215 (PRKCB)
   04071 Sphingolipid signaling pathway
    100069215 (PRKCB)
   04150 mTOR signaling pathway
    100069215 (PRKCB)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100069215 (PRKCB)
   04540 Gap junction
    100069215 (PRKCB)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    100069215 (PRKCB)
   04650 Natural killer cell mediated cytotoxicity
    100069215 (PRKCB)
   04662 B cell receptor signaling pathway
    100069215 (PRKCB)
   04666 Fc gamma R-mediated phagocytosis
    100069215 (PRKCB)
   04670 Leukocyte transendothelial migration
    100069215 (PRKCB)
   04062 Chemokine signaling pathway
    100069215 (PRKCB)
  09152 Endocrine system
   04911 Insulin secretion
    100069215 (PRKCB)
   04929 GnRH secretion
    100069215 (PRKCB)
   04912 GnRH signaling pathway
    100069215 (PRKCB)
   04921 Oxytocin signaling pathway
    100069215 (PRKCB)
   04935 Growth hormone synthesis, secretion and action
    100069215 (PRKCB)
   04918 Thyroid hormone synthesis
    100069215 (PRKCB)
   04919 Thyroid hormone signaling pathway
    100069215 (PRKCB)
   04928 Parathyroid hormone synthesis, secretion and action
    100069215 (PRKCB)
   04916 Melanogenesis
    100069215 (PRKCB)
   04925 Aldosterone synthesis and secretion
    100069215 (PRKCB)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100069215 (PRKCB)
  09154 Digestive system
   04970 Salivary secretion
    100069215 (PRKCB)
   04971 Gastric acid secretion
    100069215 (PRKCB)
   04972 Pancreatic secretion
    100069215 (PRKCB)
   04973 Carbohydrate digestion and absorption
    100069215 (PRKCB)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100069215 (PRKCB)
   04961 Endocrine and other factor-regulated calcium reabsorption
    100069215 (PRKCB)
  09156 Nervous system
   04724 Glutamatergic synapse
    100069215 (PRKCB)
   04727 GABAergic synapse
    100069215 (PRKCB)
   04725 Cholinergic synapse
    100069215 (PRKCB)
   04728 Dopaminergic synapse
    100069215 (PRKCB)
   04726 Serotonergic synapse
    100069215 (PRKCB)
   04720 Long-term potentiation
    100069215 (PRKCB)
   04730 Long-term depression
    100069215 (PRKCB)
   04723 Retrograde endocannabinoid signaling
    100069215 (PRKCB)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100069215 (PRKCB)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100069215 (PRKCB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100069215 (PRKCB)
   05206 MicroRNAs in cancer
    100069215 (PRKCB)
   05205 Proteoglycans in cancer
    100069215 (PRKCB)
   05231 Choline metabolism in cancer
    100069215 (PRKCB)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100069215 (PRKCB)
   05214 Glioma
    100069215 (PRKCB)
   05223 Non-small cell lung cancer
    100069215 (PRKCB)
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    100069215 (PRKCB)
   05022 Pathways of neurodegeneration - multiple diseases
    100069215 (PRKCB)
  09165 Substance dependence
   05031 Amphetamine addiction
    100069215 (PRKCB)
   05032 Morphine addiction
    100069215 (PRKCB)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100069215 (PRKCB)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100069215 (PRKCB)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100069215 (PRKCB)
   05161 Hepatitis B
    100069215 (PRKCB)
   05171 Coronavirus disease - COVID-19
    100069215 (PRKCB)
   05164 Influenza A
    100069215 (PRKCB)
   05163 Human cytomegalovirus infection
    100069215 (PRKCB)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100069215 (PRKCB)
   05140 Leishmaniasis
    100069215 (PRKCB)
   05143 African trypanosomiasis
    100069215 (PRKCB)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100069215 (PRKCB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ecb01001]
    100069215 (PRKCB)
Enzymes [BR:ecb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     100069215 (PRKCB)
Protein kinases [BR:ecb01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   100069215 (PRKCB)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C1_1 C2 Pkinase_C C1_2 Kinase-like CEP76-C2 APH
Other DBs
NCBI-GeneID: 100069215
NCBI-ProteinID: XP_023471875
VGNC: 51219
LinkDB
Position
13
AA seq 673 aa
MADPAAGPAPSEGEESTVRFARKGALRQKNVHEVKNHKFTARFFKQPTFCSHCTDFIWGF
GKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPASDDPRSKHKFKIHTYSSPTFCDHCGS
LLYGLIHQGMKCDTCMMNVHKRCVMNVPSLCGTDHTERRGRIYIQAHIEREVLIVVVRDA
KNLVPMDPNGLSDPYVKLKLIPDPKSESKQKTKTIKCSLNPEWNETFRFQLKESDKDRRL
SVEIWDWDLTSRNDFMGSLSFGISELQKAGVDGWFKLLSQEEGEYFNVPVPPEGGEGSEE
LRQKFERAKISQGTKTPEEKTTNTISKFDNNGNRDRMKLTDFNFLMVLGKGSFGKVMLSE
RKGTDELYAVKILKKDVVIQDDDVECTMVEKRVLALPGKPPFLTQLHSCFQTMDRLYFVM
EYVNGGDLMYHIQQVGRFKEPHAVFYAAEIAIGLFFLQSKGIIYRDLKLDNVMLDSEGHI
KIADFGMCKENIWDGVTTKTFCGTPDYIAPEIIAYQPYGKSVDWWAFGVLLYEMLAGQAP
FEGEDEDELFQSIMEHNVAYPKSMSKEAVAICKGLMTKHPGKRLGCGPEGERDIKEHAFF
RYIDWEKLERKEIQPPYKPKACGRNAENFDRFFTRHPPVLTPPDQEVIRNIDQSEFEGFS
FVNSEFLKPEVKS
NT seq 2022 nt   +upstreamnt  +downstreamnt
atggctgacccggctgcggggccggcgccgagcgagggcgaggagagcacggtgcgcttc
gcccgcaaaggcgccctccggcagaagaacgtgcacgaggtgaagaaccacaaattcacc
gcccgcttcttcaagcagcccaccttctgcagccactgcaccgacttcatctggggcttc
gggaagcaaggattccagtgccaagtctgctgttttgtcgtgcacaagcggtgccatgaa
tttgtcactttctcctgcccaggcgcggacaagggcccagcctctgatgatccccggagc
aaacacaagtttaagatccacacgtactccagccccacattttgtgaccactgtgggtca
ctgctgtatggactcatccaccaggggatgaaatgtgacacctgcatgatgaacgtccac
aagcgctgcgtgatgaacgtccccagcctctgcggcacggaccacacggagcgccgcggc
cgcatctacatccaggcccacatcgagagggaagtcctcatcgttgtcgtaagagatgct
aaaaaccttgtacctatggatcccaatggcttgtcagatccttacgtgaaactgaaactg
attcctgaccccaaaagtgagagcaagcagaagaccaaaaccatcaagtgctccctcaac
cctgagtggaatgagacgtttagattccagctgaaagaatcggacaaagacaggagactg
tctgtagagatttgggattgggatctgaccagcaggaatgacttcatgggatctttgtcg
tttgggatttctgaattgcagaaagctggtgttgatggctggtttaagttactgagccag
gaggaaggcgagtacttcaacgtgcctgtgccgccggaaggaggcgagggcagtgaagag
ctgcggcagaagttcgagagggccaagatcagtcaggggactaagactccagaagaaaag
acgaccaacaccatatccaaatttgacaacaatgggaacagggaccggatgaagctgacc
gattttaacttcctgatggtgctggggaaaggcagctttggcaaggtcatgctctcagag
cgaaagggcacagatgagctctatgctgtgaagatcctcaagaaggatgtggtgatccaa
gatgacgatgtggaatgcacgatggtggagaagcgggtgctggccctgcccgggaagccg
ccgttcctgacccagctgcactcctgctttcagaccatggaccgcctgtactttgtgatg
gagtatgtcaacgggggtgacctcatgtaccacatccaacaagttggccggtttaaggag
cctcatgctgtattttacgctgcagaaattgccatcggtctgttcttcttacagagcaag
ggcatcatttaccgtgacctaaaacttgataacgtgatgctagattcggagggccacatc
aagatcgctgattttggcatgtgtaaggaaaacatctgggacggagtgacgaccaagaca
ttctgtggcactccagactatatcgcccctgagataattgcttatcagccctatgggaag
tccgtggattggtgggcattcggagtcttgctgtatgaaatgttggctgggcaggctccc
tttgaaggggaggatgaggatgaactcttccagtccatcatggaacacaatgtggcttat
ccgaagtccatgtccaaggaggctgtggccatctgcaaagggctgatgaccaaacaccca
ggcaagcgtctgggttgtggacctgaaggcgaacgtgacatcaaagagcatgcattcttc
cggtatattgactgggagaaacttgaacgcaaagagattcagcccccgtataagccaaaa
gcctgtgggcgaaatgctgaaaacttcgacagatttttcacccgccatccaccagtccta
acacctcctgaccaggaagtcatcaggaatattgaccaatcagaattcgaaggattttcc
tttgttaactctgaatttttaaaacctgaagtcaagagctaa

DBGET integrated database retrieval system