KEGG   Equus caballus (horse): 100062924
Entry
100062924         CDS       T01058                                 

Gene name
GAB1
Definition
(RefSeq) GRB2-associated-binding protein 1 isoform X2
  KO
K09593  GRB2-associated-binding protein 1
Organism
ecb  Equus caballus (horse)
Pathway
ecb01521  EGFR tyrosine kinase inhibitor resistance
ecb04012  ErbB signaling pathway
ecb04014  Ras signaling pathway
ecb04072  Phospholipase D signaling pathway
ecb04722  Neurotrophin signaling pathway
ecb05100  Bacterial invasion of epithelial cells
ecb05205  Proteoglycans in cancer
ecb05211  Renal cell carcinoma
ecb05225  Hepatocellular carcinoma
ecb05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100062924 (GAB1)
   04014 Ras signaling pathway
    100062924 (GAB1)
   04072 Phospholipase D signaling pathway
    100062924 (GAB1)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100062924 (GAB1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100062924 (GAB1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100062924 (GAB1)
   05226 Gastric cancer
    100062924 (GAB1)
   05211 Renal cell carcinoma
    100062924 (GAB1)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    100062924 (GAB1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100062924 (GAB1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:ecb04990]
    100062924 (GAB1)
Domain-containing proteins not elsewhere classified [BR:ecb04990]
 Pleckstrin homology (PH) domain-containing proteins
  Grb-2 associated binder (Gab) family proteins
   100062924 (GAB1)
SSDB
Motif
Pfam: PH PH_11 PH_13 PH_9 PH_8 PH_3
Other DBs
NCBI-GeneID: 100062924
NCBI-ProteinID: XP_005607976
Ensembl: ENSECAG00000008570
VGNC: 18185
LinkDB
Position
2
AA seq 743 aa
MQTANEDVSCKERTGNAWKRRWFVLRSGRLTGDPDVLEYYKNDHAKKPIRIIDLNLCQQV
DAGLTFNKKEFENSYIFDINTIDRIFYLVADSEEEMNKWVRCICDICGFNPTEEDPVKPS
GGSSQAPVDLPLAINTAPPSTQVDSSSAALPPPYQLINLPPHLETLGIQEDPQDYLLLIN
CQSKKPEPTSQGSSFVSEEGEEYLLLEDFESKTSPLQTHADSAKSTSSETDCNDNVPSHK
NPASSQSKHGVNGFFQQQMMYDSPPPRAASVSVDSSLYNLPRSYSHDVLPKVSPSSTEAD
GELYVFNTPSGTSSVETQMRHVSISYDIPPTPGNTYQIPRTFPEGTLGQTSKLDTIPDIP
PPRPPKPHPAHDRSPVETCGVPRTASDTDSSHCIPIAGVPPSRSNTISTVDLNKLRKDAS
SQDCYDIPRTFPSDRSSSLEGFHNHFKIKNVLTVGSVSSEELDENYVPMNPNSPPRQHSS
SFTEPIQEANYVPMTPGTFDFSSFGMQVPPPAHMGFRSSPKTPPRRPVPVADCEPPPVDR
NLKPDRKGQSPKILRPKPHGLERTDSQTIGDFATRRKAKPAPLEIKPLPEWEELQAPVRS
PITRSFARDSSRFPMSPRPDSVHSTTSSSDSHDSEENYVPMNPNLSSEDSNLFGSNSLDG
GSSPMIKPKGDKQVEYLDLDLDSGKSTPPRKQKSSGSGSSVADERVDYVVVDQQKTLALK
STREAWTDGRQSTESETPTKSVK
NT seq 2232 nt   +upstreamnt  +downstreamnt
atgcaaaccgcgaatgaagatgtaagttgcaaagaaagaacgggaaatgcatggaagagg
agatggtttgtgttacgcagtggccgtttaaccggagatccagatgtcttggaatattac
aaaaatgatcatgccaagaagcccatccgtattattgatttaaatttatgtcagcaagtt
gatgctggattgacatttaacaaaaaagagtttgaaaacagctacattttcgatatcaac
accattgaccgtattttctacttggtagcagacagtgaggaggaaatgaataagtgggtt
cgttgcatctgtgacatctgtgggtttaatcctacggaagaagatcctgtgaagccatct
ggcggctcctcacaagcaccagtggatttacctttggctataaatacagcaccaccatcc
acccaggtggattcctcctcggctgctctgcctcctccgtatcagctcattaaccttcca
ccacatctggaaactcttggcatccaggaggatcctcaagactacctcctgctaatcaac
tgtcaaagcaagaagcctgaacccaccagccaagggtcatcttttgtttctgaagaagga
gaggaatatctactcctagaagattttgaaagcaaaacgagtccattgcaaacacacgct
gattctgccaaatccacctcttctgaaacagactgcaatgataacgttccttctcataaa
aaccctgcttcctcccagagcaaacatggagtaaatggcttttttcagcagcaaatgatg
tatgactctccaccgcctcgtgctgcatctgtttctgtagactcgagcctttataacctg
cccaggagttattcccacgatgttttaccaaaggtgtccccatcgagtaccgaagccgat
ggagaactgtatgtttttaataccccatccgggacatcgagcgtagagactcagatgagg
catgtgtctattagttatgacattcctccaacacctggtaatacttaccagattccacga
acatttccagaaggaaccttgggacagacgtcaaagctagacactattccagatattcct
ccacctcggccaccgaaaccacatccggctcatgaccgatctcctgtggaaacgtgcggc
gtcccacgcacggcctcagacactgacagtagtcactgtatccctatagcaggggtgccg
ccatctcgtagcaataccatctccaccgtggatttgaacaagctgcgaaaagatgctagt
tctcaagactgctatgatatcccacgcacatttccaagtgacagatctagttcacttgaa
ggcttccataaccactttaaaatcaaaaatgtattgacggtgggaagtgtatcaagtgaa
gaactggatgaaaattatgtcccaatgaatcccaactctccgccacgacaacattccagc
agttttacggaaccaattcaggaagcaaactatgtgccaatgaccccagggacgtttgat
ttttcttcatttggaatgcaagttccccctcctgctcacatgggcttcaggtccagccca
aagacccctcccagaagaccagttcctgttgcagactgtgaaccaccccccgtggatagg
aacctcaagccagacaggaaaggtcagagtcctaaaattttaagacccaaaccccatggt
ttagagcgaactgattcacaaaccataggtgactttgctacaagaagaaaggccaagcca
gcacctttagaaataaaacctttgccagaatgggaagaattacaagccccagttagatct
cccatcactaggagttttgctcgagactcctctaggtttcccatgtccccccggccagat
tcagtgcacagcacaacttcgagcagtgactcgcacgacagtgaagagaattatgttccc
atgaacccaaacctgtccagtgaagactcgaatctttttggcagtaacagtctcgatgga
ggaagcagtcctatgatcaagcccaaaggagacaagcaagtggaatacctagacctagat
ttagattccgggaaatccacgccaccacgtaagcaaaagagcagtggctcaggcagcagc
gtagcagatgagagagtggattatgttgtggttgaccaacagaagaccctggctctgaag
agcacccgggaagcctggacagacggcagacagtccacagagtcggaaacgccaaccaag
agtgtgaaatga

DBGET integrated database retrieval system