KEGG   Equus caballus (horse): 100063136
Entry
100063136         CDS       T01058                                 

Gene name
GNAQ
Definition
(RefSeq) guanine nucleotide-binding protein G(q) subunit alpha isoform X1
  KO
K04634  guanine nucleotide-binding protein G(q) subunit alpha
Organism
ecb  Equus caballus (horse)
Pathway
ecb04015  Rap1 signaling pathway
ecb04020  Calcium signaling pathway
ecb04022  cGMP-PKG signaling pathway
ecb04062  Chemokine signaling pathway
ecb04071  Sphingolipid signaling pathway
ecb04261  Adrenergic signaling in cardiomyocytes
ecb04270  Vascular smooth muscle contraction
ecb04371  Apelin signaling pathway
ecb04540  Gap junction
ecb04611  Platelet activation
ecb04713  Circadian entrainment
ecb04720  Long-term potentiation
ecb04723  Retrograde endocannabinoid signaling
ecb04724  Glutamatergic synapse
ecb04725  Cholinergic synapse
ecb04726  Serotonergic synapse
ecb04728  Dopaminergic synapse
ecb04730  Long-term depression
ecb04750  Inflammatory mediator regulation of TRP channels
ecb04911  Insulin secretion
ecb04912  GnRH signaling pathway
ecb04915  Estrogen signaling pathway
ecb04916  Melanogenesis
ecb04918  Thyroid hormone synthesis
ecb04921  Oxytocin signaling pathway
ecb04922  Glucagon signaling pathway
ecb04924  Renin secretion
ecb04925  Aldosterone synthesis and secretion
ecb04927  Cortisol synthesis and secretion
ecb04928  Parathyroid hormone synthesis, secretion and action
ecb04929  GnRH secretion
ecb04934  Cushing syndrome
ecb04935  Growth hormone synthesis, secretion and action
ecb04961  Endocrine and other factor-regulated calcium reabsorption
ecb04970  Salivary secretion
ecb04971  Gastric acid secretion
ecb04972  Pancreatic secretion
ecb05010  Alzheimer disease
ecb05016  Huntington disease
ecb05017  Spinocerebellar ataxia
ecb05022  Pathways of neurodegeneration - multiple diseases
ecb05135  Yersinia infection
ecb05142  Chagas disease
ecb05143  African trypanosomiasis
ecb05146  Amoebiasis
ecb05163  Human cytomegalovirus infection
ecb05170  Human immunodeficiency virus 1 infection
ecb05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100063136 (GNAQ)
   04371 Apelin signaling pathway
    100063136 (GNAQ)
   04020 Calcium signaling pathway
    100063136 (GNAQ)
   04071 Sphingolipid signaling pathway
    100063136 (GNAQ)
   04022 cGMP-PKG signaling pathway
    100063136 (GNAQ)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100063136 (GNAQ)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100063136 (GNAQ)
   04062 Chemokine signaling pathway
    100063136 (GNAQ)
  09152 Endocrine system
   04911 Insulin secretion
    100063136 (GNAQ)
   04922 Glucagon signaling pathway
    100063136 (GNAQ)
   04929 GnRH secretion
    100063136 (GNAQ)
   04912 GnRH signaling pathway
    100063136 (GNAQ)
   04915 Estrogen signaling pathway
    100063136 (GNAQ)
   04921 Oxytocin signaling pathway
    100063136 (GNAQ)
   04935 Growth hormone synthesis, secretion and action
    100063136 (GNAQ)
   04918 Thyroid hormone synthesis
    100063136 (GNAQ)
   04928 Parathyroid hormone synthesis, secretion and action
    100063136 (GNAQ)
   04916 Melanogenesis
    100063136 (GNAQ)
   04924 Renin secretion
    100063136 (GNAQ)
   04925 Aldosterone synthesis and secretion
    100063136 (GNAQ)
   04927 Cortisol synthesis and secretion
    100063136 (GNAQ)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100063136 (GNAQ)
   04270 Vascular smooth muscle contraction
    100063136 (GNAQ)
  09154 Digestive system
   04970 Salivary secretion
    100063136 (GNAQ)
   04971 Gastric acid secretion
    100063136 (GNAQ)
   04972 Pancreatic secretion
    100063136 (GNAQ)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    100063136 (GNAQ)
  09156 Nervous system
   04724 Glutamatergic synapse
    100063136 (GNAQ)
   04725 Cholinergic synapse
    100063136 (GNAQ)
   04728 Dopaminergic synapse
    100063136 (GNAQ)
   04726 Serotonergic synapse
    100063136 (GNAQ)
   04720 Long-term potentiation
    100063136 (GNAQ)
   04730 Long-term depression
    100063136 (GNAQ)
   04723 Retrograde endocannabinoid signaling
    100063136 (GNAQ)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100063136 (GNAQ)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100063136 (GNAQ)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100063136 (GNAQ)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100063136 (GNAQ)
   05016 Huntington disease
    100063136 (GNAQ)
   05017 Spinocerebellar ataxia
    100063136 (GNAQ)
   05022 Pathways of neurodegeneration - multiple diseases
    100063136 (GNAQ)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100063136 (GNAQ)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100063136 (GNAQ)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100063136 (GNAQ)
   05163 Human cytomegalovirus infection
    100063136 (GNAQ)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100063136 (GNAQ)
   05142 Chagas disease
    100063136 (GNAQ)
   05143 African trypanosomiasis
    100063136 (GNAQ)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ecb04147]
    100063136 (GNAQ)
   04031 GTP-binding proteins [BR:ecb04031]
    100063136 (GNAQ)
Exosome [BR:ecb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100063136 (GNAQ)
GTP-binding proteins [BR:ecb04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 3 (Gq/11) [OT]
    100063136 (GNAQ)
SSDB
Motif
Pfam: G-alpha Arf Gtr1_RagA TniB AAA_29
Other DBs
NCBI-GeneID: 100063136
NCBI-ProteinID: XP_023482943
Ensembl: ENSECAG00000018363
VGNC: 18419
LinkDB
Position
23
AA seq 359 aa
MTLESIMACCLSEEAKEARRINDEIERQLRRDKRDARRELKLLLLGTGESGKSTFIKQMR
IIHGSGYSDEDKRGFTKLVYQNIFTAMQAMIRAMDTLKIPYKYEHNKAHAQLVREVDVEK
VSAFENPYVDAIKSLWNDPGIQECYDRRREYQLSDSTKYYLNDLDRVADPTYLPTQQDVL
RVRVPTTGIIEYPFDLQSVIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLV
ESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIMYSHLVDYFPEYDGPQR
DAQAAREFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYNLV
NT seq 1080 nt   +upstreamnt  +downstreamnt
atgactctggagtccatcatggcgtgctgcctgagcgaggaggccaaggaagcccggcgg
atcaacgacgagatcgagcggcagctccgcagggacaagcgggacgcccgccgggagctc
aagctgctgctgctcgggactggagagagtggcaagagtacgtttatcaagcagatgaga
atcatccacgggtcaggatactctgatgaagacaaaaggggcttcaccaaactggtgtac
cagaacatcttcacagccatgcaggccatgatcagagccatggacacgctcaagatcccc
tacaagtacgagcacaataaggctcatgcacaattagttcgagaagttgatgtggagaag
gtgtctgcttttgagaatccatacgtagacgcaataaagagtttatggaatgatcctgga
atccaggaatgctatgatagacgacgagaatatcagttatctgactccaccaaatactat
cttaatgacttggaccgcgtggccgaccctacttacctgcctacgcaacaagacgtgctc
agagttcgagtccccaccacagggatcatcgaatacccctttgacttacaaagtgtcatt
ttcagaatggtcgatgtaggaggccaaaggtcagagagaagaaaatggatacactgcttt
gaaaatgtcacctctatcatgtttctagtagcgcttagtgaatatgatcaagtcctcgtg
gagtcggacaatgagaaccgaatggaggaaagcaaagcactctttagaacaattatcacg
tatccctggttccagaactcctcggttattctgttcttaaacaaaaaagatcttctagag
gagaaaattatgtattcccacctagttgactacttcccagaatacgatggaccccagaga
gatgcccaggcagctcgagaattcatcctgaagatgttcgtggacctgaacccagacagt
gacaaaattatctactcccacttcacatgcgccacagacaccgagaacatccgctttgtc
tttgctgccgtcaaggacaccatcctccagttgaacctgaaggagtacaatctagtctaa

KEGG   Equus caballus (horse): 100067327
Entry
100067327         CDS       T01058                                 

Gene name
GNA11
Definition
(RefSeq) guanine nucleotide-binding protein subunit alpha-11
  KO
K04635  guanine nucleotide-binding protein subunit alpha-11
Organism
ecb  Equus caballus (horse)
Pathway
ecb04020  Calcium signaling pathway
ecb04022  cGMP-PKG signaling pathway
ecb04270  Vascular smooth muscle contraction
ecb04540  Gap junction
ecb04725  Cholinergic synapse
ecb04730  Long-term depression
ecb04911  Insulin secretion
ecb04912  GnRH signaling pathway
ecb04925  Aldosterone synthesis and secretion
ecb04927  Cortisol synthesis and secretion
ecb04928  Parathyroid hormone synthesis, secretion and action
ecb04929  GnRH secretion
ecb04934  Cushing syndrome
ecb04935  Growth hormone synthesis, secretion and action
ecb05142  Chagas disease
ecb05146  Amoebiasis
ecb05163  Human cytomegalovirus infection
ecb05170  Human immunodeficiency virus 1 infection
ecb05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100067327 (GNA11)
   04022 cGMP-PKG signaling pathway
    100067327 (GNA11)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100067327 (GNA11)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100067327 (GNA11)
   04929 GnRH secretion
    100067327 (GNA11)
   04912 GnRH signaling pathway
    100067327 (GNA11)
   04935 Growth hormone synthesis, secretion and action
    100067327 (GNA11)
   04928 Parathyroid hormone synthesis, secretion and action
    100067327 (GNA11)
   04925 Aldosterone synthesis and secretion
    100067327 (GNA11)
   04927 Cortisol synthesis and secretion
    100067327 (GNA11)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100067327 (GNA11)
  09156 Nervous system
   04725 Cholinergic synapse
    100067327 (GNA11)
   04730 Long-term depression
    100067327 (GNA11)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100067327 (GNA11)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100067327 (GNA11)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100067327 (GNA11)
   05163 Human cytomegalovirus infection
    100067327 (GNA11)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100067327 (GNA11)
   05142 Chagas disease
    100067327 (GNA11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ecb04147]
    100067327 (GNA11)
   04031 GTP-binding proteins [BR:ecb04031]
    100067327 (GNA11)
Exosome [BR:ecb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100067327 (GNA11)
  Exosomal proteins of melanoma cells
   100067327 (GNA11)
GTP-binding proteins [BR:ecb04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 3 (Gq/11) [OT]
    100067327 (GNA11)
SSDB
Motif
Pfam: G-alpha Arf Gtr1_RagA AAA_29
Other DBs
NCBI-GeneID: 100067327
NCBI-ProteinID: XP_023502179
LinkDB
Position
7
AA seq 359 aa
MTLESMMACCLSDEVKESKRINAEIEKQLRRDKRDARRELKLLLLGTGESGKSTFIKQMR
IIHGAGYSEEDKRGFTKLVYQNIFTAMQAMIRAMETLRILYKHEHNKANALLIREVDVEK
VTTFEHRYVSAIKTLWADPGIQECYDRRREYQLSDSAKYYLTDVDRIATLGYLPTQQDVL
RVRVPTTGIIEYPFDLENIIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLV
ESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEDKILYSHLVDYFPEFDGPQR
DAQAAREFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYNLV
NT seq 1080 nt   +upstreamnt  +downstreamnt
atgactctggagtccatgatggcgtgttgcctgagcgacgaggtgaaggagtccaagcgc
atcaacgccgagatcgagaagcagctgcggcgggacaagcgcgacgcccggcgcgagctc
aagctgctgctgcttggcaccggcgagagcggcaagagcacgttcatcaagcagatgcgc
atcatccacggggccggctactcggaggaggacaagcggggcttcacgaagctggtgtac
cagaacatcttcaccgccatgcaggccatgatccgcgccatggagacgctgaggatcctg
tacaagcacgagcacaacaaggccaacgcgctcctgatccgggaagtggacgtggagaag
gtgacaaccttcgagcaccggtacgtcagcgccatcaagacgctgtgggctgaccccggc
atccaggagtgctacgaccgcaggcgcgagtaccagctctccgactccgccaagtactac
ctgacggacgtggaccgcatcgccactctgggctacctgcccacccagcaggacgtgctg
cgggtgcgcgtgccaaccacgggcatcatcgagtaccctttcgacctggagaacatcatc
ttcaggatggtggacgtgggaggacagaggtccgagcggaggaagtggatccactgcttc
gagaacgtgacgtccatcatgttcctcgtggcactcagcgagtacgaccaggtcctggtg
gagtcggacaacgagaaccgcatggaggagagcaaggcgctcttccggactatcatcacc
tacccctggttccagaactcgtccgtcatcctcttcctcaacaagaaggacctgctggag
gataagatcctctactcccacctcgtcgactacttccccgagttcgacgggccgcagcgg
gacgcgcaggccgcgcgcgagttcatcctgaagatgttcgtggacctgaaccccgacagc
gacaagatcatctactcgcacttcacgtgcgccaccgacacggagaacatccgcttcgtc
ttcgccgccgtcaaggacaccatcctgcagctgaacctgaaggagtacaacctggtgtga

DBGET integrated database retrieval system