KEGG   Equus caballus (horse): 100063190
Entry
100063190         CDS       T01058                                 

Gene name
MAP2K2
Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 2
  KO
K04369  mitogen-activated protein kinase kinase 2 [EC:2.7.12.2]
Organism
ecb  Equus caballus (horse)
Pathway
ecb01521  EGFR tyrosine kinase inhibitor resistance
ecb01522  Endocrine resistance
ecb04010  MAPK signaling pathway
ecb04012  ErbB signaling pathway
ecb04014  Ras signaling pathway
ecb04015  Rap1 signaling pathway
ecb04022  cGMP-PKG signaling pathway
ecb04024  cAMP signaling pathway
ecb04066  HIF-1 signaling pathway
ecb04068  FoxO signaling pathway
ecb04071  Sphingolipid signaling pathway
ecb04072  Phospholipase D signaling pathway
ecb04140  Autophagy - animal
ecb04150  mTOR signaling pathway
ecb04151  PI3K-Akt signaling pathway
ecb04210  Apoptosis
ecb04218  Cellular senescence
ecb04270  Vascular smooth muscle contraction
ecb04370  VEGF signaling pathway
ecb04371  Apelin signaling pathway
ecb04540  Gap junction
ecb04550  Signaling pathways regulating pluripotency of stem cells
ecb04613  Neutrophil extracellular trap formation
ecb04620  Toll-like receptor signaling pathway
ecb04650  Natural killer cell mediated cytotoxicity
ecb04660  T cell receptor signaling pathway
ecb04662  B cell receptor signaling pathway
ecb04664  Fc epsilon RI signaling pathway
ecb04720  Long-term potentiation
ecb04722  Neurotrophin signaling pathway
ecb04730  Long-term depression
ecb04810  Regulation of actin cytoskeleton
ecb04910  Insulin signaling pathway
ecb04912  GnRH signaling pathway
ecb04915  Estrogen signaling pathway
ecb04916  Melanogenesis
ecb04917  Prolactin signaling pathway
ecb04919  Thyroid hormone signaling pathway
ecb04921  Oxytocin signaling pathway
ecb04926  Relaxin signaling pathway
ecb04929  GnRH secretion
ecb04934  Cushing syndrome
ecb04935  Growth hormone synthesis, secretion and action
ecb05010  Alzheimer disease
ecb05022  Pathways of neurodegeneration - multiple diseases
ecb05132  Salmonella infection
ecb05135  Yersinia infection
ecb05160  Hepatitis C
ecb05161  Hepatitis B
ecb05163  Human cytomegalovirus infection
ecb05164  Influenza A
ecb05165  Human papillomavirus infection
ecb05166  Human T-cell leukemia virus 1 infection
ecb05167  Kaposi sarcoma-associated herpesvirus infection
ecb05170  Human immunodeficiency virus 1 infection
ecb05200  Pathways in cancer
ecb05205  Proteoglycans in cancer
ecb05206  MicroRNAs in cancer
ecb05210  Colorectal cancer
ecb05211  Renal cell carcinoma
ecb05213  Endometrial cancer
ecb05214  Glioma
ecb05215  Prostate cancer
ecb05216  Thyroid cancer
ecb05218  Melanoma
ecb05219  Bladder cancer
ecb05220  Chronic myeloid leukemia
ecb05221  Acute myeloid leukemia
ecb05223  Non-small cell lung cancer
ecb05224  Breast cancer
ecb05225  Hepatocellular carcinoma
ecb05226  Gastric cancer
ecb05230  Central carbon metabolism in cancer
ecb05231  Choline metabolism in cancer
ecb05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100063190 (MAP2K2)
   04012 ErbB signaling pathway
    100063190 (MAP2K2)
   04014 Ras signaling pathway
    100063190 (MAP2K2)
   04015 Rap1 signaling pathway
    100063190 (MAP2K2)
   04370 VEGF signaling pathway
    100063190 (MAP2K2)
   04371 Apelin signaling pathway
    100063190 (MAP2K2)
   04066 HIF-1 signaling pathway
    100063190 (MAP2K2)
   04068 FoxO signaling pathway
    100063190 (MAP2K2)
   04072 Phospholipase D signaling pathway
    100063190 (MAP2K2)
   04071 Sphingolipid signaling pathway
    100063190 (MAP2K2)
   04024 cAMP signaling pathway
    100063190 (MAP2K2)
   04022 cGMP-PKG signaling pathway
    100063190 (MAP2K2)
   04151 PI3K-Akt signaling pathway
    100063190 (MAP2K2)
   04150 mTOR signaling pathway
    100063190 (MAP2K2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100063190 (MAP2K2)
  09143 Cell growth and death
   04210 Apoptosis
    100063190 (MAP2K2)
   04218 Cellular senescence
    100063190 (MAP2K2)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100063190 (MAP2K2)
   04550 Signaling pathways regulating pluripotency of stem cells
    100063190 (MAP2K2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100063190 (MAP2K2)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    100063190 (MAP2K2)
   04620 Toll-like receptor signaling pathway
    100063190 (MAP2K2)
   04650 Natural killer cell mediated cytotoxicity
    100063190 (MAP2K2)
   04660 T cell receptor signaling pathway
    100063190 (MAP2K2)
   04662 B cell receptor signaling pathway
    100063190 (MAP2K2)
   04664 Fc epsilon RI signaling pathway
    100063190 (MAP2K2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100063190 (MAP2K2)
   04929 GnRH secretion
    100063190 (MAP2K2)
   04912 GnRH signaling pathway
    100063190 (MAP2K2)
   04915 Estrogen signaling pathway
    100063190 (MAP2K2)
   04917 Prolactin signaling pathway
    100063190 (MAP2K2)
   04921 Oxytocin signaling pathway
    100063190 (MAP2K2)
   04926 Relaxin signaling pathway
    100063190 (MAP2K2)
   04935 Growth hormone synthesis, secretion and action
    100063190 (MAP2K2)
   04919 Thyroid hormone signaling pathway
    100063190 (MAP2K2)
   04916 Melanogenesis
    100063190 (MAP2K2)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100063190 (MAP2K2)
  09156 Nervous system
   04720 Long-term potentiation
    100063190 (MAP2K2)
   04730 Long-term depression
    100063190 (MAP2K2)
   04722 Neurotrophin signaling pathway
    100063190 (MAP2K2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100063190 (MAP2K2)
   05206 MicroRNAs in cancer
    100063190 (MAP2K2)
   05205 Proteoglycans in cancer
    100063190 (MAP2K2)
   05230 Central carbon metabolism in cancer
    100063190 (MAP2K2)
   05231 Choline metabolism in cancer
    100063190 (MAP2K2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100063190 (MAP2K2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100063190 (MAP2K2)
   05225 Hepatocellular carcinoma
    100063190 (MAP2K2)
   05226 Gastric cancer
    100063190 (MAP2K2)
   05214 Glioma
    100063190 (MAP2K2)
   05216 Thyroid cancer
    100063190 (MAP2K2)
   05221 Acute myeloid leukemia
    100063190 (MAP2K2)
   05220 Chronic myeloid leukemia
    100063190 (MAP2K2)
   05218 Melanoma
    100063190 (MAP2K2)
   05211 Renal cell carcinoma
    100063190 (MAP2K2)
   05219 Bladder cancer
    100063190 (MAP2K2)
   05215 Prostate cancer
    100063190 (MAP2K2)
   05213 Endometrial cancer
    100063190 (MAP2K2)
   05224 Breast cancer
    100063190 (MAP2K2)
   05223 Non-small cell lung cancer
    100063190 (MAP2K2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100063190 (MAP2K2)
   05022 Pathways of neurodegeneration - multiple diseases
    100063190 (MAP2K2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100063190 (MAP2K2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100063190 (MAP2K2)
   05135 Yersinia infection
    100063190 (MAP2K2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100063190 (MAP2K2)
   05170 Human immunodeficiency virus 1 infection
    100063190 (MAP2K2)
   05161 Hepatitis B
    100063190 (MAP2K2)
   05160 Hepatitis C
    100063190 (MAP2K2)
   05164 Influenza A
    100063190 (MAP2K2)
   05163 Human cytomegalovirus infection
    100063190 (MAP2K2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100063190 (MAP2K2)
   05165 Human papillomavirus infection
    100063190 (MAP2K2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100063190 (MAP2K2)
   01522 Endocrine resistance
    100063190 (MAP2K2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ecb01001]
    100063190 (MAP2K2)
Enzymes [BR:ecb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     100063190 (MAP2K2)
Protein kinases [BR:ecb01001]
 Serine/threonine kinases: STE group
  STE7 family
   100063190 (MAP2K2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal Kinase-like APH Kdo Seadorna_VP7 CAMSAP_CC1
Other DBs
NCBI-GeneID: 100063190
NCBI-ProteinID: XP_023500194
Ensembl: ENSECAG00000009157
LinkDB
Position
7
AA seq 400 aa
MLARRKPVLPALTINPAIAEGPSPTSEGASEANLVDLQKKLEELELDEQQKKRLEAFLTQ
KAKVGELKDDDFERLSELGAGNGGVVTKVQHRPSGLIMARKLIHLEIKPAIRNQIIRELQ
VLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKEAKRIPEEILGKVSIAVLRG
LAYLREKHQIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQ
GTHYSVQSDIWSMGLSLVELSVGRYPIPPPDAKELEAIFGRPVVDGAEDEPPSTSPRPRP
PGRAISGHGMDSRPAMAIFELLDYIVNEPPPKLPHGAFTQDFQEFVNKCLIKNPAERADL
KMLMNHAFIKRSEVEEVDFAGWLCKTLRLNQPSTPTRTAV
NT seq 1203 nt   +upstreamnt  +downstreamnt
atgctggcccggaggaagccggtgctgccggcgctcaccatcaaccccgccatcgccgag
ggcccgtcccccaccagcgagggcgcctccgaagcgaacctggtggacctgcagaagaag
ctcgaggagctcgagctcgacgagcagcagaagaagcggctggaagccttcctcacccag
aaggccaaggtcggggagctcaaggacgatgactttgagaggctctccgagctgggagcc
ggcaacggcggggtggtcaccaaagtccagcacaggccttcgggcctcatcatggccagg
aagctgatccacctggagatcaagccggccatccggaaccagatcatccgcgagctgcag
gtacttcacgagtgcaactcgccctacatcgtcggcttctacggggccttctacagcgac
ggcgagatcagcatctgcatggagcacatggacggcggctctctggaccaggtgttgaaa
gaagccaagagaatccccgaggagattctggggaaggtcagcatcgcggtgctccggggc
ctggcgtatctccgggagaagcaccagatcatgcaccgagacgtgaagccgtccaacatc
ctggtcaactccagaggggagatcaagctgtgcgatttcggggtgagcgggcagctcatc
gactccatggccaactccttcgtggggactcgctcgtacatgtcccccgagcgcctgcag
ggcacgcactactccgtgcagtcggacatctggagcatgggcctgtccctggtggagctg
tccgtcggcaggtaccccatcccgccgcccgacgccaaggagctcgaggccatcttcggc
cggcccgtggttgacggggcggaagacgagccccccagcacctcgccgcggcccaggccc
cccggacgcgccatcagtggtcacgggatggacagccggccggccatggccatcttcgaa
ttgctggactatattgtgaatgagcctcctcccaagctgccccacggcgccttcacgcag
gacttccaggagtttgtaaataaatgcctcattaagaacccagccgagcgagcggatctg
aagatgctcatgaaccacgccttcatcaagcggtcggaggtggaagaagtggattttgcc
ggctggctgtgtaagacgctgcggctgaaccagcccagcacgcccacgcgcacggccgtg
tga

KEGG   Equus caballus (horse): 100065996
Entry
100065996         CDS       T01058                                 

Gene name
MAP2K1
Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 1 isoform X2
  KO
K04368  mitogen-activated protein kinase kinase 1 [EC:2.7.12.2]
Organism
ecb  Equus caballus (horse)
Pathway
ecb01521  EGFR tyrosine kinase inhibitor resistance
ecb01522  Endocrine resistance
ecb04010  MAPK signaling pathway
ecb04012  ErbB signaling pathway
ecb04014  Ras signaling pathway
ecb04015  Rap1 signaling pathway
ecb04022  cGMP-PKG signaling pathway
ecb04024  cAMP signaling pathway
ecb04062  Chemokine signaling pathway
ecb04066  HIF-1 signaling pathway
ecb04068  FoxO signaling pathway
ecb04071  Sphingolipid signaling pathway
ecb04072  Phospholipase D signaling pathway
ecb04114  Oocyte meiosis
ecb04140  Autophagy - animal
ecb04150  mTOR signaling pathway
ecb04151  PI3K-Akt signaling pathway
ecb04210  Apoptosis
ecb04218  Cellular senescence
ecb04270  Vascular smooth muscle contraction
ecb04370  VEGF signaling pathway
ecb04371  Apelin signaling pathway
ecb04380  Osteoclast differentiation
ecb04510  Focal adhesion
ecb04540  Gap junction
ecb04550  Signaling pathways regulating pluripotency of stem cells
ecb04613  Neutrophil extracellular trap formation
ecb04620  Toll-like receptor signaling pathway
ecb04650  Natural killer cell mediated cytotoxicity
ecb04660  T cell receptor signaling pathway
ecb04662  B cell receptor signaling pathway
ecb04664  Fc epsilon RI signaling pathway
ecb04666  Fc gamma R-mediated phagocytosis
ecb04668  TNF signaling pathway
ecb04720  Long-term potentiation
ecb04722  Neurotrophin signaling pathway
ecb04725  Cholinergic synapse
ecb04726  Serotonergic synapse
ecb04730  Long-term depression
ecb04810  Regulation of actin cytoskeleton
ecb04910  Insulin signaling pathway
ecb04912  GnRH signaling pathway
ecb04914  Progesterone-mediated oocyte maturation
ecb04915  Estrogen signaling pathway
ecb04916  Melanogenesis
ecb04917  Prolactin signaling pathway
ecb04919  Thyroid hormone signaling pathway
ecb04921  Oxytocin signaling pathway
ecb04926  Relaxin signaling pathway
ecb04928  Parathyroid hormone synthesis, secretion and action
ecb04929  GnRH secretion
ecb04934  Cushing syndrome
ecb04935  Growth hormone synthesis, secretion and action
ecb05010  Alzheimer disease
ecb05022  Pathways of neurodegeneration - multiple diseases
ecb05034  Alcoholism
ecb05132  Salmonella infection
ecb05135  Yersinia infection
ecb05160  Hepatitis C
ecb05161  Hepatitis B
ecb05163  Human cytomegalovirus infection
ecb05164  Influenza A
ecb05165  Human papillomavirus infection
ecb05166  Human T-cell leukemia virus 1 infection
ecb05167  Kaposi sarcoma-associated herpesvirus infection
ecb05170  Human immunodeficiency virus 1 infection
ecb05200  Pathways in cancer
ecb05205  Proteoglycans in cancer
ecb05206  MicroRNAs in cancer
ecb05210  Colorectal cancer
ecb05211  Renal cell carcinoma
ecb05212  Pancreatic cancer
ecb05213  Endometrial cancer
ecb05214  Glioma
ecb05215  Prostate cancer
ecb05216  Thyroid cancer
ecb05218  Melanoma
ecb05219  Bladder cancer
ecb05220  Chronic myeloid leukemia
ecb05221  Acute myeloid leukemia
ecb05223  Non-small cell lung cancer
ecb05224  Breast cancer
ecb05225  Hepatocellular carcinoma
ecb05226  Gastric cancer
ecb05230  Central carbon metabolism in cancer
ecb05231  Choline metabolism in cancer
ecb05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100065996 (MAP2K1)
   04012 ErbB signaling pathway
    100065996 (MAP2K1)
   04014 Ras signaling pathway
    100065996 (MAP2K1)
   04015 Rap1 signaling pathway
    100065996 (MAP2K1)
   04370 VEGF signaling pathway
    100065996 (MAP2K1)
   04371 Apelin signaling pathway
    100065996 (MAP2K1)
   04668 TNF signaling pathway
    100065996 (MAP2K1)
   04066 HIF-1 signaling pathway
    100065996 (MAP2K1)
   04068 FoxO signaling pathway
    100065996 (MAP2K1)
   04072 Phospholipase D signaling pathway
    100065996 (MAP2K1)
   04071 Sphingolipid signaling pathway
    100065996 (MAP2K1)
   04024 cAMP signaling pathway
    100065996 (MAP2K1)
   04022 cGMP-PKG signaling pathway
    100065996 (MAP2K1)
   04151 PI3K-Akt signaling pathway
    100065996 (MAP2K1)
   04150 mTOR signaling pathway
    100065996 (MAP2K1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100065996 (MAP2K1)
  09143 Cell growth and death
   04114 Oocyte meiosis
    100065996 (MAP2K1)
   04210 Apoptosis
    100065996 (MAP2K1)
   04218 Cellular senescence
    100065996 (MAP2K1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100065996 (MAP2K1)
   04540 Gap junction
    100065996 (MAP2K1)
   04550 Signaling pathways regulating pluripotency of stem cells
    100065996 (MAP2K1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100065996 (MAP2K1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    100065996 (MAP2K1)
   04620 Toll-like receptor signaling pathway
    100065996 (MAP2K1)
   04650 Natural killer cell mediated cytotoxicity
    100065996 (MAP2K1)
   04660 T cell receptor signaling pathway
    100065996 (MAP2K1)
   04662 B cell receptor signaling pathway
    100065996 (MAP2K1)
   04664 Fc epsilon RI signaling pathway
    100065996 (MAP2K1)
   04666 Fc gamma R-mediated phagocytosis
    100065996 (MAP2K1)
   04062 Chemokine signaling pathway
    100065996 (MAP2K1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100065996 (MAP2K1)
   04929 GnRH secretion
    100065996 (MAP2K1)
   04912 GnRH signaling pathway
    100065996 (MAP2K1)
   04915 Estrogen signaling pathway
    100065996 (MAP2K1)
   04914 Progesterone-mediated oocyte maturation
    100065996 (MAP2K1)
   04917 Prolactin signaling pathway
    100065996 (MAP2K1)
   04921 Oxytocin signaling pathway
    100065996 (MAP2K1)
   04926 Relaxin signaling pathway
    100065996 (MAP2K1)
   04935 Growth hormone synthesis, secretion and action
    100065996 (MAP2K1)
   04919 Thyroid hormone signaling pathway
    100065996 (MAP2K1)
   04928 Parathyroid hormone synthesis, secretion and action
    100065996 (MAP2K1)
   04916 Melanogenesis
    100065996 (MAP2K1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100065996 (MAP2K1)
  09156 Nervous system
   04725 Cholinergic synapse
    100065996 (MAP2K1)
   04726 Serotonergic synapse
    100065996 (MAP2K1)
   04720 Long-term potentiation
    100065996 (MAP2K1)
   04730 Long-term depression
    100065996 (MAP2K1)
   04722 Neurotrophin signaling pathway
    100065996 (MAP2K1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100065996 (MAP2K1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100065996 (MAP2K1)
   05206 MicroRNAs in cancer
    100065996 (MAP2K1)
   05205 Proteoglycans in cancer
    100065996 (MAP2K1)
   05230 Central carbon metabolism in cancer
    100065996 (MAP2K1)
   05231 Choline metabolism in cancer
    100065996 (MAP2K1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100065996 (MAP2K1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100065996 (MAP2K1)
   05212 Pancreatic cancer
    100065996 (MAP2K1)
   05225 Hepatocellular carcinoma
    100065996 (MAP2K1)
   05226 Gastric cancer
    100065996 (MAP2K1)
   05214 Glioma
    100065996 (MAP2K1)
   05216 Thyroid cancer
    100065996 (MAP2K1)
   05221 Acute myeloid leukemia
    100065996 (MAP2K1)
   05220 Chronic myeloid leukemia
    100065996 (MAP2K1)
   05218 Melanoma
    100065996 (MAP2K1)
   05211 Renal cell carcinoma
    100065996 (MAP2K1)
   05219 Bladder cancer
    100065996 (MAP2K1)
   05215 Prostate cancer
    100065996 (MAP2K1)
   05213 Endometrial cancer
    100065996 (MAP2K1)
   05224 Breast cancer
    100065996 (MAP2K1)
   05223 Non-small cell lung cancer
    100065996 (MAP2K1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100065996 (MAP2K1)
   05022 Pathways of neurodegeneration - multiple diseases
    100065996 (MAP2K1)
  09165 Substance dependence
   05034 Alcoholism
    100065996 (MAP2K1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100065996 (MAP2K1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100065996 (MAP2K1)
   05135 Yersinia infection
    100065996 (MAP2K1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100065996 (MAP2K1)
   05170 Human immunodeficiency virus 1 infection
    100065996 (MAP2K1)
   05161 Hepatitis B
    100065996 (MAP2K1)
   05160 Hepatitis C
    100065996 (MAP2K1)
   05164 Influenza A
    100065996 (MAP2K1)
   05163 Human cytomegalovirus infection
    100065996 (MAP2K1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100065996 (MAP2K1)
   05165 Human papillomavirus infection
    100065996 (MAP2K1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100065996 (MAP2K1)
   01522 Endocrine resistance
    100065996 (MAP2K1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ecb01001]
    100065996 (MAP2K1)
Enzymes [BR:ecb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     100065996 (MAP2K1)
Protein kinases [BR:ecb01001]
 Serine/threonine kinases: STE group
  STE7 family
   100065996 (MAP2K1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal Kinase-like Seadorna_VP7 NAD_binding_6
Other DBs
NCBI-GeneID: 100065996
NCBI-ProteinID: XP_001496470
Ensembl: ENSECAG00000010640
VGNC: 19926
LinkDB
Position
1
AA seq 371 aa
MKPERTNLEALQKKLEELELDEQQRKRLEAFLTQKQKVGELKDDDFEKISELGAGNGGVV
FKVAHKPSGLVMARKLIHLEIKPAIRNQIIRELQVLHECNSPYIVGFYGAFYSDGEISIC
MEHMDGGSLDQVLKKAGRIPEQILGKVSIAVIKGLTYLREKHKIMHRDVKPSNILVNSRG
EIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHYSVQSDIWSMGLSLVEMAVGRYP
IPPPDAKELELMFGCQVEGDAAETPPRPRTPGRPLSSYGMDSRPPMAIFELLDYIVNEPP
PKLPSGVFSLEFQDFVNKCLIKNPAERADLKQLMVHAFIKRSDAEEVDFAGWLCSTIGLN
QPSTPTHAAGV
NT seq 1116 nt   +upstreamnt  +downstreamnt
atgaagccggagaggaccaacctggaggccttgcagaagaagctggaggagctggagctc
gatgaacagcagcgaaagcgccttgaggcctttcttactcagaagcagaaggttggggaa
ctgaaggatgatgactttgagaagatcagtgagctgggtgctggcaatggtggtgtggta
ttcaaggttgcccacaaaccgtctggtttggtcatggccagaaagctaattcacctggag
atcaagcctgcaatccggaaccagatcataagggagctgcaggttctacatgagtgcaac
tccccatatattgtgggcttctatggcgcattctacagcgatggtgagatcagcatctgc
atggagcacatggatgggggttccttggatcaagtcctaaagaaagctggaagaattcct
gagcaaattttaggaaaagttagcattgctgtaataaaaggcctgacgtatctgagggag
aagcacaagattatgcacagagatgtcaagccctccaacatcctagtgaactcccgtggg
gagatcaagctgtgtgattttggggtcagcgggcagctcatcgactccatggccaactcc
ttcgtgggcacaaggtcttacatgtcgccggaaagactccaggggactcattattcagtg
cagtcggacatctggagcatggggctctctctggttgagatggcggtcgggaggtatccc
atccctcctccagatgccaaggagctggagctgatgtttgggtgccaagtggagggagat
gcggctgagactccgcctaggccaaggacccctggaagacccctcagctcttatggaatg
gacagccgacctcctatggcaatttttgagttactggattacatagtcaacgagcctcct
cccaagctgcccagtggagtattcagtctggaatttcaggattttgtgaataaatgctta
atcaaaaaccctgcagagagagcagatttgaagcaactcatggttcacgcttttatcaag
agatctgatgccgaggaagtggattttgcaggttggctctgctccaccattggccttaac
cagcccagcacaccaacccacgcggctggcgtctaa

DBGET integrated database retrieval system