KEGG   Equus caballus (horse): 100063409
Entry
100063409         CDS       T01058                                 

Gene name
LRP6
Definition
(RefSeq) low-density lipoprotein receptor-related protein 6 isoform X1
  KO
K03068  low density lipoprotein receptor-related protein 5/6
Organism
ecb  Equus caballus (horse)
Pathway
ecb04150  mTOR signaling pathway
ecb04310  Wnt signaling pathway
ecb04928  Parathyroid hormone synthesis, secretion and action
ecb05010  Alzheimer disease
ecb05022  Pathways of neurodegeneration - multiple diseases
ecb05200  Pathways in cancer
ecb05224  Breast cancer
ecb05225  Hepatocellular carcinoma
ecb05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100063409 (LRP6)
   04150 mTOR signaling pathway
    100063409 (LRP6)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    100063409 (LRP6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100063409 (LRP6)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100063409 (LRP6)
   05226 Gastric cancer
    100063409 (LRP6)
   05224 Breast cancer
    100063409 (LRP6)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100063409 (LRP6)
   05022 Pathways of neurodegeneration - multiple diseases
    100063409 (LRP6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ecb04131]
    100063409 (LRP6)
Membrane trafficking [BR:ecb04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Low-density lipoprotein receptor (LDLR) family proteins
    100063409 (LRP6)
SSDB
Motif
Pfam: Ldl_recept_b FXa_inhibition Ldl_recept_a DUF5050 SGL cEGF
Other DBs
NCBI-GeneID: 100063409
NCBI-ProteinID: XP_001501348
Ensembl: ENSECAG00000007129
VGNC: 19764
UniProt: F7DHA1
LinkDB
Position
6
AA seq 1613 aa
MGAVLRSLLACSFCVLLRAAPLLLYANRRDLRLVDATNGKENATIVVGGLEDAAAVDFVF
GHGLIYWSDVSEEAIKRTEFNKTESVQNVVVSGLLSPDGLACDWLGEKLYWTDSETNRIE
VSNLDGSLRKVLFWQELDQPRAIALDPSSGFMYWTDWGEVPKIERAGMDGSSRFIIINTE
IYWPNGLTLDYEERKLYWADAKLNFIHKSNLDGTNRQAVVKGSLPHPFALTLFEDTLYWT
DWNTHSILACNKYTGEGLREIHSNIFSPMDIHAFSQQRQPNATNPCGIDNGGCSHLCLMS
PVKPFYQCACPTGVKLLENGKTCKDGATELLLLARRTDLRRISLDTPDFTDIVLQLEDIR
HAIAIDYDPLEGYIYWTDDEVRAIRRSFIDGSGSQFVVTAQIAHPDGIAVDWVARNLYWT
DTGTDRIEVTRLNGTMRKILISEDLEEPRAIVLDPMVGYMYWTDWGEIPKIERAALDGSD
RVVLVNTSLGWPNGLALDYDEGKIYWGDAKTDKIEVMNTDGTGRRVLVEDKIPHIFGFTL
LGDYVYWTDWQRRSIERVHKRSAEREIIIDQLPDLMGLKATNVHRIIGSNPCAEENGGCS
HLCLYRPQGLRCACPIGFELISDMKTCIVPEAFLLFSRRADIRRISLETNNNNVAIPLTG
VKEASALDFDVTDNRIYWTDISLKTISRAFMNGSALEHVVEFGLDYPEGMAVDWLGKNLY
WADTGTNRIEVSKLDGQHRQVLVWKDLDSPRALALDPAEGFMYWTEWGGKPKIDRAAMDG
SERTTLVPNVGRANGLTIDYAKRRLYWTDLDTNLIESSNMLGLNREVIADDLPHPFGLTQ
YQDYIYWTDWSRRSIERANKTSGQNRTIIQGHLDYVMDILVFHSSRQAGWNECASSNGHC
SHLCLAVPVGGFVCGCPAHYSLNADNRTCSAPTTFLLFSQKSAINRMVIDEQQSPDIILP
IHSLRNVRAIDYDPLDKQLYWIDSRQNMIRKAQEDGSQGFTVVVSSVPNQNLEIQPYDLS
IDIYSRYIYWTCEATNVINVTRLDGRSIGVVLKGEQDRPRAIVVNPEKGYMYFTNLQERS
PKIERAALDGTEREVLFFSGLSKPIALALDSRLGKLFWADSDLRRIESSDLSGANRIVLE
DSNILQPVGLTVFENWLYWIDKQQQMIEKIDMTGREGRTKVQARIAQLSDIHAVKELNLQ
EYRQHPCAQDNGGCSHICLVKGDGTTRCSCPMHLVLLQDELSCGEPPTCSPQQFTCFTGE
IDCIPVAWRCDGFTECEDHSDELNCPVCSESQFQCASGQCIDGALRCNGDANCQDKSDEK
NCEVLCLIDQFRCANGQCIGKHKKCDHNVDCSDKSDELDCYPTEEPAPQATNTVGSVIGV
IVTIFVSGTIYFICQRMLCPRMKGDGETMTNDYVVHGPASVPLGYVPHPSSLSGSLPGMS
RGKSMISSLSIMGGSSGPPYDRAHVTGASSSSSSSTKGTYFPAILNPPPSPATERSHYTM
EFGYSSNSPSTHRSYSYRPYSYRHFAPPTTPCSTDVCDSDYAPSRRMTSVATAKGYTSDL
NYDSEPVPPPPTPRSQYLSAEENYESCPPSPYTERSYSHHLYPPPPSPCTDSS
NT seq 4842 nt   +upstreamnt  +downstreamnt
atgggggccgtcctgaggagcctcctggcctgcagtttctgtgtgctcctgagagcggcc
cctttgttgctctacgcaaacagacgggacttacgattggttgatgctacgaatggcaaa
gagaatgctacaattgtcgttggaggcttggaggatgcagctgcggtggactttgtgttt
ggtcatggcttgatatactggagtgatgtcagcgaagaagctattaaacggacagagttt
aacaaaactgagagtgtacagaatgttgttgtttctggattattgtcccctgatgggctg
gcatgtgattggcttggagaaaaattatactggacagattctgaaactaatcggattgaa
gtttcaaatttagatggatctttacgaaaagttttattttggcaagagttggatcaaccc
agagctattgccttagatccttcaagtgggttcatgtactggacagactggggagaagta
ccaaagatagaacgtgctggaatggatggttcaagtcgcttcattataataaacactgaa
atttactggccaaatggactaactttggattatgaggaacggaagctttattgggcagat
gcaaaacttaatttcatccacaaatcaaatctggatggaacaaatcggcaggcagtggtt
aaaggttccctgccgcatccttttgccttgacgttatttgaggacacattgtactggact
gactggaatacacactccattttggcttgcaacaagtatactggcgagggtctgcgtgaa
atccattctaacatcttctctcccatggatatacatgccttcagccaacagaggcagcca
aatgctacaaatccatgtggaattgataatggtggttgttcccacttgtgtttgatgtct
ccagtcaagcctttttatcagtgtgcttgcccaactggggtcaaactcctggaaaatgga
aagacctgcaaggatggtgccactgaattattacttttagcccgaaggacagatttgagg
cgcatttctttggatacaccagatttcacagacattgttctacaattggaagacatccgt
catgccattgccatagattatgatcctttggaaggctatatctactggactgatgatgaa
gtgagggccatacgccgctcattcatagatggatctggtagtcagtttgtggtcaccgct
caaattgcacatcctgatggtattgctgttgactgggttgcccgaaatctttattggaca
gacactggcactgatcgaatagaagtgacaaggctcaatgggaccatgaggaagatcttg
atttcagaggatttagaggaaccccgggctattgtgttagatcccatggttgggtacatg
tattggactgactggggagaaatcccaaaaattgagcgagcagctctggatggttctgac
cgagtagtgttggttaacacttctcttggttggccaaatggtttagccttggattatgat
gaaggcaaaatatactggggagatgccaaaacagacaaaattgaggttatgaataccgat
ggcactgggagacgagtactagtggaagacaaaattcctcacatatttggatttacttta
ctgggtgactatgtttactggactgactggcagaggcgtagcatcgaaagagtacacaaa
cgaagtgcagagagggaaatcatcatagatcagctccctgaccttatgggcctaaaggcc
acaaatgttcatcgaatcattggttccaacccctgcgctgaggaaaatgggggatgtagc
catctttgcctctatagacctcagggccttcgctgtgcctgccccattggctttgaactc
atcagtgacatgaagacttgcattgtcccagaggctttccttttgttttcacggagagca
gatatccggcgaatatctttggaaactaacaataacaatgtggccattccacttactggt
gtcaaagaagcttctgctttggattttgatgtgacagacaaccgaatttactggactgat
atatcactcaagaccatcagcagagcctttatgaatggcagtgcactggaacatgtggta
gaattcggcttagattatccagaaggcatggcagtagactggcttgggaagaacttgtac
tgggcagacacaggaacgaatcgaattgaggtgtcaaagttggatgggcagcacagacaa
gttttggtgtggaaagacctagatagtcccagagctcttgcattggaccctgctgaagga
tttatgtattggactgaatggggtggaaaacctaagatagacagagctgccatggatgga
agtgaacgcactacattagttccaaatgtgggccgggcaaatggcctgactattgattat
gctaaaaggaggctttattggacagacctagacaccaatttaatagaatcttcaaatatg
cttggactcaaccgtgaagttatagcagatgacttgcctcatccttttggcttaactcag
taccaagattacatctactggacggactggagccgacgcagcattgagcgtgccaacaaa
accagcggccaaaaccgcaccatcattcagggccacttggattatgtgatggacatcctc
gtctttcactcctctcggcaggcagggtggaatgagtgtgcttccagcaatgggcactgc
tcccacctctgcttggctgtgccagttggaggttttgtttgcggatgccctgcccactac
tctcttaatgctgacaacaggacttgtagtgctccaactactttcctgctcttcagtcaa
aagagtgccatcaaccgcatggtgattgatgaacagcaaagccctgacatcatccttcct
atccacagccttcggaatgttcgggccattgactatgacccactggacaagcagctctat
tggattgactcacgacagaacatgatccggaaagcacaagaagatggcagtcagggcttt
actgtggttgtgagctcggttccaaatcagaacctagaaatacaaccctatgacctcagc
attgatatttatagccgctacatctattggacttgtgaagccaccaatgtcattaatgta
acaagattagatgggagatccattggagtggtgctgaaaggcgagcaagacagacctcga
gccattgtggtaaacccggagaaaggctatatgtattttaccaatcttcaggaaaggtct
ccaaaaattgaacgggctgctttggatggaacagaacgggaagtcctctttttcagtggc
ttaagtaaaccaattgctttagcccttgatagcagattgggcaagctcttttgggctgat
tcagatctccggcgaattgaaagcagtgacctctcaggtgccaaccggatagtgttagaa
gactctaatatcttgcagcctgtgggactgactgtgtttgaaaactggctatattggatt
gataagcagcagcaaatgattgaaaaaattgacatgacaggtcgagagggtagaacaaaa
gtccaggctcgaattgcccagcttagtgacattcatgcagtgaaggagctgaaccttcaa
gaatatagacagcacccttgtgctcaggataacggtggctgttcacatatttgtcttgta
aaaggagatggtacgacaaggtgctcttgccccatgcacttggttctgcttcaagatgag
ctatcatgtggagaacccccaacgtgttctcctcagcagtttacttgtttcacgggagaa
attgactgtatccctgtggcttggaggtgcgatgggtttactgaatgtgaagaccacagt
gatgagctcaactgtcctgtatgctcagagtcccagttccagtgtgccagtgggcagtgt
attgatggtgccctccgatgcaatggagatgcaaactgtcaggataaatcagatgagaag
aactgtgaagtgctttgtttaattgatcagttccgctgtgctaatggtcagtgcattgga
aaacacaagaaatgtgatcataatgtggattgcagtgacaagtcagatgaactggattgt
tatccaactgaggagccagcaccacaggccaccaatacagttggttcagttattggagta
attgtcaccatttttgtgtctggaaccatatactttatctgccagaggatgttgtgtcca
cgtatgaagggagatggagaaaccatgactaatgactatgtagttcacggaccagcttct
gttccccttggttatgtgccacaccccagttctttgtcaggatctcttccaggaatgtct
cgaggtaaatcaatgatcagctcgctcagtatcatgggaggaagcagtggacccccttat
gatcgcgctcatgtcacaggagcatcatcaagtagttcttcaagcaccaaaggcacttac
tttcctgcaattttgaaccctccgccatccccagctacagaacgatcacattacactatg
gaatttggttattcttcaaacagtccttctactcataggtcctacagttacagaccctac
agttaccggcactttgcaccccccaccacaccctgcagcacagatgtctgtgacagtgac
tatgctcccagccggagaatgacctcagtggcaacagccaagggctacactagtgacttg
aactatgactcagagcctgtgcccccacctcccacaccccgaagccaatacttgtcggca
gaagagaactatgaaagctgcccaccctctccgtacacagagaggagctactctcaccat
ctctacccaccgcccccttctccgtgtacagactcctcctga

KEGG   Equus caballus (horse): 100147353
Entry
100147353         CDS       T01058                                 

Gene name
LRP5
Definition
(RefSeq) low-density lipoprotein receptor-related protein 5 isoform X1
  KO
K03068  low density lipoprotein receptor-related protein 5/6
Organism
ecb  Equus caballus (horse)
Pathway
ecb04150  mTOR signaling pathway
ecb04310  Wnt signaling pathway
ecb04928  Parathyroid hormone synthesis, secretion and action
ecb05010  Alzheimer disease
ecb05022  Pathways of neurodegeneration - multiple diseases
ecb05200  Pathways in cancer
ecb05224  Breast cancer
ecb05225  Hepatocellular carcinoma
ecb05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100147353 (LRP5)
   04150 mTOR signaling pathway
    100147353 (LRP5)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    100147353 (LRP5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100147353 (LRP5)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100147353 (LRP5)
   05226 Gastric cancer
    100147353 (LRP5)
   05224 Breast cancer
    100147353 (LRP5)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100147353 (LRP5)
   05022 Pathways of neurodegeneration - multiple diseases
    100147353 (LRP5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ecb04131]
    100147353 (LRP5)
Membrane trafficking [BR:ecb04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Low-density lipoprotein receptor (LDLR) family proteins
    100147353 (LRP5)
SSDB
Motif
Pfam: Ldl_recept_b FXa_inhibition Ldl_recept_a DUF5050 SGL Insulin_TMD
Other DBs
NCBI-GeneID: 100147353
NCBI-ProteinID: XP_023510375
LinkDB
Position
12
AA seq 1611 aa
MAGAGISRLWFRCGRDASPLLLFANRRDVRLVDAGGVKLESTIVVSGLEDAAAVDFQFSK
GAVYWTDVSEEAIKQTYLNQTGAAVQNVVISGLVSPDGLACDWVGKKLYWTDSETNRIEV
ANLNGTSRKVLFWQDLDQPRAIALDPAHGYMYWTDWGETPRIERAGMDGSTRKIIVDSDI
YWPNGLTIDLEEQKLYWADAKLSFIHRANLDGSFRQKVVEGSLTHPFALTLSGDTLYWTD
WQTRSIHACNKRTGEKRKEILSALYSPMDIQVLSPERQPYFHTRCEEDNGGCSHLCLLSP
REPFYTCACPTGVQLQDNGKTCKAGAEEVLLLARRTDLRRISLDTPDFTDIVLQVDDIRH
AIAIDYDPLEGYVYWTDDEVRAIRRAYLDGSGAQTLVNTEINDPDGIAVDWVARNLYWTD
TGTDRIEVTRLNGTSRKILVSEDLDEPRAIVLHPAMGLMYWTDWGENPKIECANLDGQER
RVLVNTSLGWPNGLALDLQEGRLYWGDAKTDKIEVINVDGTKRRTLLEDKLPHIFGFTLL
GDFIYWTDWQRRSIERVHKVKASRDVIIDQLPDLMGLKAVNVAKVVGTNPCADGNGGCSH
LCFFTPHATKCGCPIGLELLSDMKTCIVPEAFLVFTSRAAIHRISLETNNNDVAIPLTGV
KEASALDFDVSNNHIYWTDVSLKTISRAFMNGSSVEHVIEFGLDYPEGMAVDWMGKNLYW
ADTGTNRIEVARLDGQFRQVLVWRDLDNPRSLALDPTKGYIYWTEWGGKPRIVRAFMDGT
NCMTLVDKVGRANDLTIDYADQRLYWTDLDTNMIESSNMLGQERVVIADDLPHPFGLTQY
SDYIYWTDWNLHSIERADKTNGRNRTLIQGHLDFVMDILVFHSSRQDGLNDCMHNNGQCG
QLCLAIPGGHRCSCASHYTLDPSSRNCSPPTTFLLFSQKCAISRMIPDDQHSPDLILPLH
GLRNVKAIDYDPLDKFIYWVDGRQNIKRAKDDGTQPFVLTSPGQSQSPDRQPHDLSIDIY
SRTLFWTCEATNTINVHRLNGEAMGVVLRGDRDKPRAIVVNAERGYLYFTNMQDRAAKIE
RAALDGTEREVLFTTGLIRPVALVVDNALGKLFWVDADLKRIESCDLSGANRLTLEDANI
VQPMGLTVLGKHLYWIDRQQQMIERVEKTTGDKRTRVQGRVAHLTSIHAVEDVSLEEFSA
HPCARDNGGCSHICIAKGDGTPRCSCPVHLVLLQNLLTCGEPPTCSPDQFACATGEIDCI
PGAWRCDGFPECDDQSDEEGCPVCSAAQFPCARGQCVDLRLRCDGEADCQDRSDEADCDA
SLNAGPLLAAICLPNQFRCASGQCVLIKQQCDSFPDCMDGSDELMCEITKPPSDDTPAHS
SAIGPVIGIILSLFVMGGVYFVCQRVVCQRYAGATGPFPHEYVSGTPHVPLNFIAPGGSQ
HGPFTGISCGKSMMGSVSLMGGRGGVPLYDRNHVTGASSSSSSSTKATLYPPILNPPPSP
ATDPSLYNMDMFYSSNIPATARPYRPYIIRGVAPPTTPCSTDVCDSDYSASRWKASKYYL
DLNSDSDPYPPPPTPHSQYLSAEDSCPPSPATERSYFHLFPPPPSPCTDSS
NT seq 4836 nt   +upstreamnt  +downstreamnt
atggctggcgctgggatttccagactctggttccgctgcggtagagacgcctcacctctc
ctgttgtttgccaaccgccgggacgtgcggctggtggatgccggcggagtcaagctggag
tccaccatcgtggtcagcggcctggaggacgcggccgcggtcgatttccagttctccaag
ggagccgtgtactggacggacgtgagcgaggaggccatcaagcagacctacctgaaccag
acgggggccgccgtgcagaacgtggtcatctccggcctggtctcgcccgacggcctggcc
tgcgactgggtcggcaagaagctgtactggacggactcggagaccaatcgcatcgaggtg
gccaacctcaacggaacgtcacgcaaggtcctcttctggcaggaccttgaccagccgcgg
gccatcgccttggaccctgctcacgggtacatgtactggacagactggggtgagaccccc
cgaatcgagcgggcagggatggacggcagcacccggaagatcatcgtggactcggacatt
tactggcccaacgggctgaccatcgacctggaggagcagaagctttactgggccgatgcc
aagctcagcttcattcaccgcgccaacctggatggctcattccggcagaaggtggtggag
ggcagcctgacgcaccccttcgccctgacgctttctggggacaccctgtactggacagac
tggcagacccgctccattcacgcctgtaacaagaggactggagagaagaggaaggagatc
ctgagtgctctctactcgcccatggacattcaagtgctcagccccgagcggcagccctac
ttccacacgcgatgtgaggaggacaatggtggctgctcccacctgtgcctgctgtcccca
agggaacctttctacacgtgcgcctgccccactggcgtccagcttcaggacaacggcaag
acgtgcaaggcaggggccgaggaggtgctgctgctggcccggcggacggacctgcggagg
atctcgctggacacgccggacttcacggacatcgtgctgcaggtggacgacatccggcac
gccatcgccatcgactacgacccgctggagggctacgtgtactggacggacgacgaggtg
cgggccatccgcagggcctacctggacggctcgggggcgcagacgctggtcaacaccgag
atcaacgaccccgacggcatcgctgtcgactgggtggcccgcaacctctactggaccgac
acgggcaccgaccgcatcgaggtgacgcggctcaatggcacctcccgcaagatcctggtg
tccgaggacctggacgagccccgcgccattgtgctgcatcctgcgatgggcctcatgtac
tggacggactggggcgaaaaccccaagatcgagtgtgctaacctggacggacaggaacga
cgcgtgctggtgaacacgtccctcggctggcccaacggcctggccctggacctgcaggag
ggcaggctgtactggggagacgccaagacggacaaaattgaggtgatcaacgtcgacgga
acaaagaggcggacgctcctggaggacaagctcccgcacattttcgggttcacgctgctg
ggggacttcatctactggaccgactggcaacggcgtagcatcgagcgtgtgcacaaggtc
aaggcgagccgggacgtgatcatcgaccagctgcccgacctgatggggctcaaggccgtg
aacgtggccaaggtcgtcgggaccaacccgtgcgcggacgggaacggggggtgcagccac
ttgtgcttcttcaccccccacgccaccaagtgcggctgccccatcggcctggagctgctg
agtgacatgaagacctgcatcgtccccgaggccttccttgtgttcaccagcagagccgcc
atccacaggatctccctggagaccaacaacaacgacgtggccatcccgctcacgggcgtc
aaggaggcctccgcgctggacttcgacgtgtccaacaaccacatctactggacggacgtc
agcctgaagaccatcagccgggccttcatgaacgggagctccgtcgagcacgtcatcgag
tttggcctcgactacccggagggcatggcggtcgactggatgggcaagaacctctactgg
gcggacaccgggaccaacaggatcgaagtggcccggctggacgggcagttccggcaggtc
ctcgtgtggagggacctggacaacccgaggtcgctggccctggaccccaccaaaggctac
atctactggaccgagtggggtggcaagcccaggatcgtgcgggccttcatggacgggacc
aactgcatgacgctggtggacaaggtgggccgggccaatgacctcaccatcgactacgcc
gaccagcgtctctactggaccgacctggacaccaacatgatcgagtcgtccaacatgctg
ggccaggagcgggttgtgatcgccgacgacctcccgcaccccttcggcctgacgcagtac
agcgattacatctactggaccgattggaacctgcacagcatcgagagggccgacaagacc
aatggccgcaaccgcaccctcatccagggccacctggacttcgtcatggacatcctggtg
ttccactcctcccgccaggacggcctcaacgactgcatgcacaacaacgggcagtgtggc
cagctgtgcctcgccatccctggtggccaccgctgcagctgcgcctcacattacaccctg
gaccccagtagccgcaactgtagcccacccaccaccttcttgctgttcagccagaaatgt
gccatcagccggatgatccccgacgaccagcacagcccggatctcatcctgcccctgcac
ggactgaggaatgtcaaggccattgactatgacccactggacaagttcatctattgggtg
gacgggcgccagaacatcaagcgagccaaggacgacgggacccagcctttcgttttgacc
tctcctggccaaagccagagcccagaccggcagccccacgatctcagcatcgacatctac
agccggacgctcttctggacctgcgaggccaccaacaccatcaacgtccaccggctgaac
ggggaggccatgggcgtggtgctccgtggggaccgcgacaagccgagggccatcgtcgtc
aacgctgagcgagggtacctgtacttcaccaacatgcaggaccgagccgccaagatcgag
cgcgcagccctggacggcaccgagcgtgaggtcctcttcaccacaggcctcatccgcccc
gtggccctcgtggtggacaacgcgctgggcaagctcttctgggtggacgcagacctaaag
cgcatcgaaagctgtgacctgtcaggggccaaccgcctgaccctagaggacgccaacatc
gtgcagcccatgggcctgaccgtgctgggcaaacacctctactggatcgaccgccagcag
cagatgatcgagcgtgtggagaagaccaccggggacaagcggacgcgcgtccagggccgt
gtcgcccacctgaccagcatccacgctgtggaggacgtcagcctggaggagttctcggcc
cacccatgtgcccgggacaacggtggctgctcccacatctgcattgccaagggtgacggg
acgccaaggtgctcatgcccggtccacctcgtgctcctgcagaacctgctgacctgtggt
gagcctcccacgtgctcccctgaccagttcgcgtgcgccactggggagatcgactgcatc
cccggggcctggcgctgcgacggcttccccgagtgcgacgaccagagcgacgaggagggc
tgtcccgtgtgctcggccgcccagttcccctgcgcgcgcggccagtgcgtggacctgcgg
ctgcgctgcgacggcgaggccgactgccaggaccgctcggacgaggccgactgcgatgcc
tctctgaacgcagggcccctccttgcagccatctgcctgcccaaccagttccgctgcgcc
agtggccagtgcgtcctcatcaagcagcaatgcgattccttcccagactgcatggacggc
tccgacgagctcatgtgcgagatcaccaagcccccctcggatgacacccccgcccatagc
agcgccatcgggccagtcattggcatcatcctctccctttttgtcatgggtggcgtctac
tttgtctgccagcgtgtggtgtgtcagcgctacgcgggggccaccgggcccttcccgcat
gagtatgtcagcgggacccctcacgtgcccctcaacttcatagccccgggcggctctcag
catggtcccttcacaggcatctcctgtggcaagtccatgatgggctcggtgagcctcatg
gggggccggggcggggtgcccctctacgaccggaaccacgtcactggggcctcgtccagc
agctcgtccagcaccaaggccacgctgtacccaccgatcctgaacccgccgccgtcccct
gccacggacccctccctgtacaacatggacatgttctactcttcaaacattcccgccacc
gcgagaccctacaggccctacatcatccgaggtgtggcgccccccacgacgccctgcagc
acggacgtgtgcgacagcgactacagcgccagccgctggaaggccagcaagtactacctg
gatttgaactcggactcagacccctacccgcccccgcccacgccccacagccaatacctg
tcggccgaggacagctgcccgccctcgcccgccaccgagaggagttacttccatctcttc
ccgcccccaccatccccctgcacggactcatcctga

DBGET integrated database retrieval system