KEGG   Equus caballus (horse): 100064022
Entry
100064022         CDS       T01058                                 

Gene name
CDKN1A
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
ecb  Equus caballus (horse)
Pathway
ecb01522  Endocrine resistance
ecb01524  Platinum drug resistance
ecb04012  ErbB signaling pathway
ecb04066  HIF-1 signaling pathway
ecb04068  FoxO signaling pathway
ecb04110  Cell cycle
ecb04115  p53 signaling pathway
ecb04151  PI3K-Akt signaling pathway
ecb04218  Cellular senescence
ecb04630  JAK-STAT signaling pathway
ecb04921  Oxytocin signaling pathway
ecb04928  Parathyroid hormone synthesis, secretion and action
ecb04934  Cushing syndrome
ecb05160  Hepatitis C
ecb05161  Hepatitis B
ecb05163  Human cytomegalovirus infection
ecb05165  Human papillomavirus infection
ecb05166  Human T-cell leukemia virus 1 infection
ecb05167  Kaposi sarcoma-associated herpesvirus infection
ecb05169  Epstein-Barr virus infection
ecb05200  Pathways in cancer
ecb05202  Transcriptional misregulation in cancer
ecb05203  Viral carcinogenesis
ecb05205  Proteoglycans in cancer
ecb05206  MicroRNAs in cancer
ecb05210  Colorectal cancer
ecb05211  Renal cell carcinoma
ecb05212  Pancreatic cancer
ecb05213  Endometrial cancer
ecb05214  Glioma
ecb05215  Prostate cancer
ecb05216  Thyroid cancer
ecb05217  Basal cell carcinoma
ecb05218  Melanoma
ecb05219  Bladder cancer
ecb05220  Chronic myeloid leukemia
ecb05222  Small cell lung cancer
ecb05223  Non-small cell lung cancer
ecb05224  Breast cancer
ecb05225  Hepatocellular carcinoma
ecb05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100064022 (CDKN1A)
   04630 JAK-STAT signaling pathway
    100064022 (CDKN1A)
   04066 HIF-1 signaling pathway
    100064022 (CDKN1A)
   04068 FoxO signaling pathway
    100064022 (CDKN1A)
   04151 PI3K-Akt signaling pathway
    100064022 (CDKN1A)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100064022 (CDKN1A)
   04115 p53 signaling pathway
    100064022 (CDKN1A)
   04218 Cellular senescence
    100064022 (CDKN1A)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100064022 (CDKN1A)
   04928 Parathyroid hormone synthesis, secretion and action
    100064022 (CDKN1A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100064022 (CDKN1A)
   05202 Transcriptional misregulation in cancer
    100064022 (CDKN1A)
   05206 MicroRNAs in cancer
    100064022 (CDKN1A)
   05205 Proteoglycans in cancer
    100064022 (CDKN1A)
   05203 Viral carcinogenesis
    100064022 (CDKN1A)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100064022 (CDKN1A)
   05212 Pancreatic cancer
    100064022 (CDKN1A)
   05225 Hepatocellular carcinoma
    100064022 (CDKN1A)
   05226 Gastric cancer
    100064022 (CDKN1A)
   05214 Glioma
    100064022 (CDKN1A)
   05216 Thyroid cancer
    100064022 (CDKN1A)
   05220 Chronic myeloid leukemia
    100064022 (CDKN1A)
   05217 Basal cell carcinoma
    100064022 (CDKN1A)
   05218 Melanoma
    100064022 (CDKN1A)
   05211 Renal cell carcinoma
    100064022 (CDKN1A)
   05219 Bladder cancer
    100064022 (CDKN1A)
   05215 Prostate cancer
    100064022 (CDKN1A)
   05213 Endometrial cancer
    100064022 (CDKN1A)
   05224 Breast cancer
    100064022 (CDKN1A)
   05222 Small cell lung cancer
    100064022 (CDKN1A)
   05223 Non-small cell lung cancer
    100064022 (CDKN1A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100064022 (CDKN1A)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100064022 (CDKN1A)
   05161 Hepatitis B
    100064022 (CDKN1A)
   05160 Hepatitis C
    100064022 (CDKN1A)
   05163 Human cytomegalovirus infection
    100064022 (CDKN1A)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100064022 (CDKN1A)
   05169 Epstein-Barr virus infection
    100064022 (CDKN1A)
   05165 Human papillomavirus infection
    100064022 (CDKN1A)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100064022 (CDKN1A)
   01522 Endocrine resistance
    100064022 (CDKN1A)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 100064022
NCBI-ProteinID: XP_023480611
Ensembl: ENSECAG00000021543
VGNC: 16363
LinkDB
Position
20
AA seq 164 aa
MSEPARDARPIPRGSKACRRLFGPVDGEQLRRDCDALMASCAQEARERWNFDFVTETPLE
GDFAWERVRGLGLPKLYLSPGPRGGRDDLRGGKRPSTSPALLQGTAEEDHVDLSLSCTLL
PHPPERPEGSPGEPGTSQGRKRRQTIMTDFYHSKRRRIFSKRKP
NT seq 495 nt   +upstreamnt  +downstreamnt
atgtcggagccggccagggatgctcgtccgatcccgcgtggcagcaaggcctgccgccgc
ctcttcggcccggtggacggcgagcagctgcgccgagactgtgacgcgctgatggccagc
tgcgcacaggaggcccgggagcgatggaacttcgattttgtcaccgagacaccgctggag
ggcgacttcgcctgggagcgcgtgcggggcctcggcctgcccaagctctacctgtccccg
gggccccgggggggccgggacgacctgagagggggcaagcggcccagcacgtcgcctgcc
ctgctgcaggggacagccgaggaggaccacgtggacctgtcgctgtcctgtaccctcctg
cctcacccccctgagcggcctgaggggtccccgggggagcctggcacctctcagggccga
aaacggcggcagaccatcatgacagatttctatcactccaaacgccgccggatcttctcc
aagaggaagccctaa

DBGET integrated database retrieval system