KEGG   Equus caballus (horse): 100064341Help
Entry
100064341         CDS       T01058                                 

Gene name
TUFM
Definition
(RefSeq) elongation factor Tu, mitochondrial
  KO
K02358  elongation factor Tu
Organism
ecb  Equus caballus (horse)
Brite
Translation factors [BR:ecb03012]
 Eukaryotic Type
  Elongation factors
   100064341 (TUFM)
 Prokaryotic Type
   100064341 (TUFM)
Mitochondrial biogenesis [BR:ecb03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    100064341 (TUFM)
Exosome [BR:ecb04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100064341 (TUFM)
  Exosomal proteins of breast cancer cells
   100064341 (TUFM)
  Exosomal proteins of colorectal cancer cells
   100064341 (TUFM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase cobW
Motif
Other DBs
NCBI-GeneID: 100064341
NCBI-ProteinID: XP_001502276
Ensembl: ENSECAG00000019763
VGNC: 24665
UniProt: F7E244
LinkDB All DBs
Position
13
AA seq 451 aa AA seqDB search
MAAATLLRAPLFSGLGAGPTPLLQGLLRPLKVPALSHLCRGLAVEAKKTYVRDKPHVNVG
TIGHVDHGKTTLTAAITKILAEGGGAKFKKYEEIDNAPEERARGITINAAHVEYSTAARH
YAHTDCPGHADYVKNMITGTAPLDGCILVVAANDGPMPQTREHLLLAKQIGVEHVVVYVN
KADAVQDSEMVELVELEIRELLTEFGYKGEETPVIVGSALCALEQRDPELGVKSVQKLLD
AVDTYIPVPTRDLEKPFLLPVESVYSIPGRGTVVTGTLERGILKKGDECEFLGHSKNIRT
VVTGIEMFHKSLERAEAGDNLGALVRGLKREDLRRGLVMAKPGTIQPHQKVEAQVYILSK
EEGGRHKPFVSHFMPVMFSLTWDMACRVILPPGKELAMPGEDLKLSLILRQPMILEKGQR
FTLRDGNRTIGTGLVTDTPTMTEEDKNIKWS
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atggcggccgccaccctgctgcgcgcgcctctcttcagcggtctcggcgccggcccaacc
ccgctactgcagggtctattgcggccgctgaaggtcccagcactgtcccacttgtgtcgc
ggcctggccgtggaggccaagaagacctatgtgcgcgacaagccccatgtgaacgtgggt
accatcggccatgtggaccacggcaagaccacactgaccgctgccatcactaaaatttta
gctgagggaggtggagccaagtttaagaaatatgaggagattgacaatgccccggaggag
cgagcccgtggtatcacaatcaatgcggcacatgtggagtacagcactgctgcccgccac
tatgcccacacagactgtccgggtcacgcagattacgttaagaatatgatcacaggcacc
gctcccctcgacggctgcatcctggtggtggcagccaatgatggccccatgccccagacc
cgagagcacttactgctggccaagcagattggagtagaacatgttgtggtgtatgtgaat
aaggcagatgctgtccaggactctgagatggtggagctagttgagctggagatccgggaa
ctactcactgagtttggctacaaaggggaggagacccctgtcatcgtaggctctgccctc
tgtgccctcgagcaacgtgaccctgagctaggcgtgaagtctgtgcagaagctgctggac
gctgtggacacctacatcccagtgcctaccagggacctggagaagcctttcttgctgcct
gtagagtcagtttactctatccctggccggggcacagtggtgacaggtacactagagcgt
ggcattttgaaaaagggagacgagtgtgagttcctgggacacagcaagaacattcgcacg
gtggtgacaggcattgagatgttccacaagagcctagagagggcagaggcaggtgacaac
cttggggccctggtccgaggcttgaagcgggaggacttgaggcgaggcctggtcatggcc
aagccaggtaccatccaacctcaccagaaagtggaggcacaggtttacatcctcagcaag
gaggaaggtggccgtcacaagccctttgtatcccacttcatgcccgtcatgttctccctg
acttgggacatggcctgtcgtgtcattttgcctccagggaaggagcttgccatgcctggg
gaggatctaaagctcagcctaatcttgcggcagccaatgatcttagaaaaaggccagcgt
ttcaccctgcgagatggcaaccggaccatcggcaccggtcttgtcactgacacgccaacc
atgactgaggaggacaagaacatcaagtggagttga

DBGET integrated database retrieval system