KEGG   Equus caballus (horse): 100064486Help
Entry
100064486         CDS       T01058                                 

Gene name
MGAM
Definition
(RefSeq) maltase-glucoamylase, intestinal isoform X2
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
ecb  Equus caballus (horse)
Pathway
ecb00052  Galactose metabolism
ecb00500  Starch and sucrose metabolism
ecb01100  Metabolic pathways
ecb04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    100064486 (MGAM)
   00500 Starch and sucrose metabolism
    100064486 (MGAM)
 09150 Organismal Systems
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100064486 (MGAM)
Enzymes [BR:ecb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     100064486 (MGAM)
    3.2.1.20  alpha-glucosidase
     100064486 (MGAM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110 Abhydro_lipase
Motif
Other DBs
NCBI-GeneID: 100064486
NCBI-ProteinID: XP_005609519
Ensembl: ENSECAG00000009647
VGNC: 20159
LinkDB All DBs
Position
4
AA seq 1847 aa AA seqDB search
MARKKWKNFTTLELMLSALLLVLFIITIPIFVLSARDSLGSEDPGTTVTPDPGTTVTLNP
SSTAIPDHETTTTVPASAECPVVNELERINCIPDQPPTKATCDQRGCCWNPQGPISVPWC
YYSQSHGYQMEDNLVNTNAGFTAQLKRLPSPSLFGNDVNNVLLTAECQTSNRFHFKLTDQ
NQDRYEVPHEHVQSFNGNAASALTYEVTVSKQPFSIKVTRRSNNRVLFDSSIGPLLFADQ
FLQLSIRLPSANVYGLGEHVHQQYRHDMNWKTWPIFNRDTTPNGDGTNLYGAQTFFLCLE
DASGLSFGVFLLNSNAMEVSLQPAPAVTYRTIGGILDFYVFLGNTPEQVVQEYLELIGRP
ALPSYWALGFHLSRYDYGSLDNMKEVVERNRAAQLPYDVQHADIDYMDERKDFTYNPVDF
KDFPEFAKELHNNGQKLIIIVDPAISNNSSPSQPYGPYDRGSDMKIWVNASNGVTPLIGE
VWPGKTVFPDYTNPQCAVWWAREFELFHNQVDFDGIWIDMNEVSNFIDGSVSGCSTSDLN
YPPFTPRVLDGYLFSKTLCMDAVQYWGKQYDVHNVYGYSMAIATAEAVNTVFPSKRSFIL
TRSTFAGSGKFAAHWLGDNTATWNDLRWSIPGILEFNLFGIPMVGPDICGFFLDSSEELC
RRWMQLGAFYPFSRNHNGQGYKAQDPAFFGADSLLVNSSRHYLTIRYTLLPYLYTLFYRA
HSRGDTVARPLLHEFYGDSSTWDVHQQFLWGPGLLITPVLEEGAEKVMAYMPDAVWYDYE
TGGRVRWRKQQVEMDLPGDKIGLHLRGGYIFPTQQPATTTVASRRNPLGLIIALDENKEA
KGELFWDDGETKDTVANQVYLLCEFSVTQNRLDVKILQSTYKDPNNLVFKEIKILGTQEP
WNVTVKHNGVSSQMSPNVTYDSNLQVALITELDLILGEAYTVEWELKVADEEKIDCYPDE
NGVSAENCTARGCVWEESSSPGVPFCYFVSDLYSVSDVQYDTHGATAVISLNSSPYAYAL
PSIPVNSLHLNVTYHKNDMLQFKIYDPNNNRYEVPVPLNIPQVPSSTSESRLYDVLIKKN
PFGIEIRRKSTGTVIWDSQLLGFTFNDMFIRISTRLPSRYLYGFGENEHTAFRRDLNWHT
WGMFSRDQPPGYKKNSYGVHPYYMGLEEDGSAHGVLLLNSNAMDVTFQPLPALTYRTTGG
ILDFYVFLGPTPEIVTQQYTELIGRPVMVPYWSLGFQLCRYGYENDTEIANLYDDMVAAQ
IPYDVQYSDIDYMERQMDFTLSPKFAGFPDLITRMHADGMRVILILDPAISGNETQPYPA
FTRGVEDDVFIKAPGGGGIVWGKVWPDFPDVVVNDSLDWDTQVELYRAYTAFPDFFRNST
VKWWKREFEELYSNPQNPEKSLKFDGMWIDMNEPASFVNGAVPPGCMNATLNHPPYMPYL
ESRDSGLSSKTLCMESEQILPDGSRVRHYDVHSLYGWSQTRPTYEAVQEVTGQRGIVITR
STFPSSGRWAGHWLGDNTAAWDQLRKSIIGMMEFSLFGISYTGADICGFFQDAEYEMCAR
WMQLGAFYPFSRNHNTIGTRRQDPVSWDATFVNISKTVLQTRYTLLPYLYTLMHLAHTEG
STVVRPLLHEFVSDQVTWDIDSQFLLGPAFLVSPVLEPNARNVTAYFPRARWYDYYTGED
IKARGEWKSLPAPLDHINLHVRGGYILPWQEPAQNTHLSRQKFIGFKVALDDDGTAEGCL
FWDDGQSIDTYEKGLYYLANFSASQNTMQSHVIFNQYIVDTNPLKLGYIEIWGVGSAPVS
NVSVSLSSTVITPAFTYNPTTQVLNIDVTSRDISLHNFISLTWSSTL
NT seq 5544 nt NT seq  +upstreamnt  +downstreamnt
atggcaagaaagaagtggaaaaatttcactactttggagcttatgctcagcgcacttctg
cttgtgttatttatcatcactattcctatatttgtgctgtcagctagagattctttggga
tcagaagatcctgggacgacagtgaccccagatcctgggacgacagttaccctcaatcct
agttcgacagctatcccagatcatgagacaacaactaccgtccctgcttctgcagagtgc
ccagtggtgaatgaattggaacggataaactgcatccctgaccagccaccaacaaaggcc
acatgtgaccagcgtggctgctgttggaatcctcagggacccataagtgtgccctggtgc
tactattctcagagtcatggttatcaaatggaggacaaccttgtaaacacaaatgcagga
ttcacagcccagttgaaaaggttgccttctccatctctgtttggaaatgatgtcaacaat
gtccttctcacagcggaatgtcagacatctaatcgtttccactttaagttaactgaccaa
aaccaggacaggtacgaagtgccccatgaacacgtgcaatccttcaatggaaatgctgct
tctgccttgacctatgaagttacggtctcaaaacagccatttagcatcaaagtgaccaga
agaagcaacaatcgtgttctgtttgactcaagcattgggcccctcttgtttgctgatcag
ttcctgcagctctccatccgtctgccgagcgccaatgtgtatgggctgggagaacatgtg
caccagcagtaccgtcatgatatgaattggaagacctggcccatatttaatagggacaca
acccccaatggggatggaactaacttgtatggtgcacagacgttcttcctgtgtcttgaa
gatgctagtggattgtcgtttggagtgtttctgttgaacagcaatgccatggaggtttct
ctccagcctgccccggcggtcacttaccgcaccatcgggggtattcttgatttctatgtg
ttcttgggaaacacgccagagcaagtcgttcaagagtatctggagctcattggacgacca
gccctaccttcatactgggcacttggatttcatctcagtcgttatgattatgggagcctg
gacaacatgaaagaagtcgtggagagaaatcgtgcagcacaacttccttacgacgttcag
catgctgatattgattatatggatgagaggaaggatttcacttataatccagtagatttt
aaagacttcccagagtttgctaaggagttacacaataatggacagaaactcatcatcatt
gtggatccagccatctccaacaactcttccccaagtcaaccctatggcccctatgacagg
ggttcagatatgaagatatgggtgaatgcttcaaatggagtgactccactcattggggag
gtctggcctggaaaaactgtgtttcctgattataccaaccctcagtgtgctgtttggtgg
gcaagggaatttgagcttttccacaaccaagtggactttgatggaatctggattgatatg
aatgaagtctccaatttcattgatggttccgtgtcaggatgttccacaagcgatctaaat
tatcccccattcactcccagagtccttgatgggtacctgttctccaagactctctgcatg
gatgcagtgcagtactggggcaagcaatatgacgtccacaatgtgtacggctactcgatg
gcgattgccacagcagaagcggtcaatactgtgttccctagtaagagaagctttattcta
acccgttctacctttgcgggatctggcaagtttgcagcccattggttaggagacaacaca
gccacctggaatgaccttcgatggtccatccctggcatccttgagttcaacctttttggt
atccctatggtgggtcctgacatatgtggctttttcttggattcctctgaagagctctgc
aggcggtggatgcagctgggagcattttatccattttccaggaatcacaatggccaaggc
tacaaggcccaggatcctgccttctttggagctgactctctgctggtgaattcctccagg
cactaccttaccatccgctatactctattgccatatctctacaccctcttctaccgagct
cacagccggggggacacggtggccaggccccttctgcatgagttctatggtgacagcagc
acttgggatgtgcaccaacagtttttatgggggcccggcctcctcatcactccagttcta
gaggagggtgcagagaaagtgatggcatatatgcctgatgctgtctggtatgattatgag
actgggggccgagtgagatggaggaagcaacaagtggagatggatcttcctggggacaaa
atcgggcttcatcttcgaggaggatatatcttccctacacaacagccagccacaaccact
gtagccagtcgaaggaaccctcttggtcttatcattgctctagatgagaacaaagaagca
aaaggcgaacttttctgggatgatggggaaaccaaagacactgtggcaaatcaagtttat
ctcttatgtgagttttctgtcacccaaaaccgattagatgtgaagattttgcaatcaacc
tacaaagaccccaataatttagtatttaaagagattaaaatccttggaacccaggaacct
tggaatgttacagtgaaacacaacggtgtctcaagtcaaatgtctcctaatgtcacttat
gactcaaacctacaggttgcccttatcacagaacttgatcttatcctgggagaagcatac
actgtggagtgggagttgaaggtagcggatgaagaaaaaatagactgttatccagatgag
aatggtgtttctgcagaaaattgcactgcccgtggctgtgtctgggaggaatccagttct
cctggagtccctttttgctatttcgtcagtgacttatactctgtcagtgatgttcagtat
gacacccatggggccacagctgtcatctctttaaattcctctccttatgcctatgctttg
ccctcaatacccgtgaactccctccatctgaatgtgacctaccataagaatgacatgctg
cagtttaagatttatgatcccaacaacaaccggtatgaagttccagtccctctcaacata
ccccaggttccatccagcacctctgagagtcgactctatgatgtcctcattaagaagaat
ccatttgggattgaaattcgccgaaagagtacaggcactgtaatttgggactctcagctc
cttggcttcaccttcaatgacatgttcatccgaatctccactcgccttccttcccggtac
ctctacggctttggggaaaatgagcacacagcctttcggagagacttgaactggcacaca
tgggggatgttttcccgagaccaacccccagggtacaagaagaattcctatggagtccac
ccctactacatggggctggaggaggatggcagtgcccatggggtgctcctgctaaacagc
aatgccatggatgtgacattccagcctttgcctgccttgacataccgcaccacaggggga
attctggacttttacgtgttcttggggccaactccagagattgtcactcagcaatacact
gagttgattggtcggccggtgatggttccttactggtccttggggtttcagctgtgtcgc
tatggatacgagaatgacactgagattgccaacttgtatgatgacatggtggctgcccag
atcccctatgatgtacaatactcagacatcgactacatggagcggcagatggacttcacc
ctcagccccaagtttgctggatttccagatctgattactcgcatgcatgctgatgggatg
cgggtcatcctcattctggatccagccatttctggcaatgagacacagccctatcctgca
ttcacccggggtgtggaagatgacgtcttcatcaaagctccaggtggtggaggcattgtc
tggggaaaggtctggcctgattttcctgatgttgttgtaaatgattctttagactgggat
actcaagtggagctataccgagcttatacagccttcccagactttttccgtaattcaact
gtcaaatggtggaagagggagtttgaagaactatacagcaacccacagaatccagagaag
agcttgaagtttgatggcatgtggattgacatgaatgaaccggcaagctttgtgaatggg
gcagttcctccaggctgcatgaatgccactctgaaccaccctccctatatgccatatttg
gagtccagggacagcggtctgagcagcaagaccctttgcatggagagtgagcagatcctg
ccagatggctcccgggtgcggcactatgatgtgcacagcctgtacgggtggtcccagacc
agacccacatacgaagctgtgcaggaggtgacaggacagcgagggattgtcatcactcgt
tccacattcccctcttctggccgctgggcaggacactggttgggagacaacacggctgca
tgggaccaactgaggaaatctatcattggcatgatggagtttagcctctttggcatatcc
tatacaggagcagatatttgtgggttctttcaagatgctgaatatgagatgtgtgctcgc
tggatgcaactgggggccttttacccattctcaaggaaccacaacaccattgggaccagg
agacaagaccctgtgtcctgggatgctacctttgtgaatatctccaaaactgtcctgcag
accagatacactctgttgccgtatctctacaccctgatgcacttggcccacacggagggc
agcactgttgtgcggcctcttctccatgagtttgtgtcagaccaggtgacctgggatata
gacagtcagttcctgctgggcccagccttcctggtcagccctgtcttggagcctaatgcc
agaaacgtcactgcatatttccccagagcccgctggtatgattactacacgggtgaggac
attaaagcaaggggagagtggaagtccttgccagcccctcttgaccacatcaatcttcat
gtccgagggggctacatcctgccctggcaagagcctgcacagaacacccacttaagccgt
cagaaattcataggtttcaaggttgcattggatgacgatgggactgctgaaggttgtctc
ttctgggatgatgggcaaagcattgatacctatgaaaaaggactctattatctggccaac
ttttctgccagccagaatacgatgcagagtcatgtaattttcaaccaatacatcgttgac
acaaaccctttgaaactgggctacattgagatctggggagtgggcagtgctcctgtttcc
aatgtcagtgtctctctgagcagcacagttataacacccgccttcacctacaaccctaca
acacaggtgttaaacatcgatgtgaccagcagagacatcagcctacataatttcatctca
ttgacatggagcagcactctgtga

DBGET integrated database retrieval system