KEGG   Equus caballus (horse): 100064559
Entry
100064559         CDS       T01058                                 

Gene name
ETS1
Definition
(RefSeq) protein C-ets-1 isoform X2
  KO
K02678  C-ets-1
Organism
ecb  Equus caballus (horse)
Pathway
ecb04014  Ras signaling pathway
ecb04218  Cellular senescence
ecb05166  Human T-cell leukemia virus 1 infection
ecb05200  Pathways in cancer
ecb05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100064559 (ETS1)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    100064559 (ETS1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100064559 (ETS1)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    100064559 (ETS1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100064559 (ETS1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ecb03000]
    100064559 (ETS1)
Transcription factors [BR:ecb03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters Ets-type
    100064559 (ETS1)
SSDB
Motif
Pfam: Ets SAM_PNT HSF_DNA-bind
Other DBs
NCBI-GeneID: 100064559
NCBI-ProteinID: XP_001505149
Ensembl: ENSECAG00000010897
VGNC: 17700
UniProt: A0A3Q2I2Q8
LinkDB
Position
7
AA seq 441 aa
MKAAVDLKPTLTIIKTEKVDLELFPSPDMECADVPLLTPSSKEMMSQALKATFSGFSKEQ
QRLGIPKDPRQWTETHVRDWVMWAVNEFSLKGVDFQKFCMNGAALCALGKDCFLELAPDF
VGDILWEHLEILQKEDVKPYPVNGVNPTYPESRYTSDYFISYGIEHAQCVPPSEFSEPSF
ITESYQTLHPISSEELLSLKYENDYPSVILRDPLQTDTLQTDYFAIKQEVVTPDNMCMGR
TSRGKLGGQDSFESIESYDSCDRLTQSWSSQSSFNSLQRVPSYDSFDSEDYPAALPNHKP
KGTFKDYVRDRADLNKDKPVIPAAALAGYTGSGPIQLWQFLLELLTDKSCQSFISWTGDG
WEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQS
LLGYTPEELHAMLDVKPDADE
NT seq 1326 nt   +upstreamnt  +downstreamnt
atgaaggcggccgtcgatctcaaaccgactctcaccatcatcaagacggaaaaagtcgat
ctggagcttttcccctccccggatatggaatgtgcagatgtcccactattaactccaagc
agcaaagaaatgatgtctcaagcattgaaagctactttcagtggtttctctaaagagcag
caacgactgggaattccaaaagacccccggcagtggacagaaacccacgttcgggactgg
gtgatgtgggctgtgaacgagttcagcctgaagggtgtggacttccagaagttctgtatg
aatggagcagccctctgtgcactggggaaagactgctttcttgagctggccccggacttc
gttggggacatcttgtgggaacatctggagatcctgcagaaagaagatgtcaaaccatat
ccagttaatggagtcaaccccacctatccagaatcccgttatacctcggattacttcatt
agctatgggatcgagcacgctcagtgcgttcctccgtcggagttctcagagcccagtttc
atcacagagtcctaccagacgctccatcctatcagctcggaggaactcctctccctcaag
tatgagaacgactacccctcagtcatcctccgggaccctctgcagacagacaccttgcag
acagactacttcgccatcaaacaagaagttgtaaccccagacaacatgtgcatggggagg
accagtcgtggtaaactcgggggccaggactcttttgagagcatagagagctacgatagt
tgtgatcgcctcacccagtcctggagcagccagtcatctttcaacagcctgcagcgtgtt
ccctcctatgacagcttcgactcagaggactatccagccgccctgcccaaccacaagccc
aagggcaccttcaaggactatgtgcgtgaccgtgctgacctcaacaaggacaagcctgtc
attcctgctgctgccctggctggctacacaggcagtggaccaatccagctgtggcagttt
cttctggaattactcactgataaatcctgtcagtcttttatcagctggacaggagatggc
tgggaattcaagctttctgatccagatgaggtggccaggagatggggaaaaaggaaaaac
aaacctaagatgaattatgagaaactgagccgtggcctacgctactattatgacaaaaac
atcatccataagacagcgggtaaacgctatgtgtaccgttttgtgtgcgacctgcagagc
ctcctggggtacacgcccgaggagctccacgccatgctggatgtcaagcccgatgccgat
gagtga

DBGET integrated database retrieval system