KEGG   Equus caballus (horse): 100064588Help
Entry
100064588         CDS       T01058                                 

Definition
(RefSeq) intestinal-type alkaline phosphatase isoform X1
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
ecb  Equus caballus (horse)
Pathway
ecb00730  Thiamine metabolism
ecb00790  Folate biosynthesis
ecb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    100064588
   00790 Folate biosynthesis
    100064588
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ecb04147]
    100064588
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ecb00537]
    100064588
Enzymes [BR:ecb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     100064588
Exosome [BR:ecb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100064588
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ecb00537]
 Enzymes
  100064588
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme
Motif
Other DBs
NCBI-GeneID: 100064588
NCBI-ProteinID: XP_001495497
LinkDB All DBs
Position
6
AA seq 536 aa AA seqDB search
MRGAWVLLLLLGLRLRLSLGVIPVEEEDPAFWNRQAAQALDTAKKLQPIQTAAKNLIIFL
GDGMGVPTVTATRILKAQMDGKLGPETPLAMDHFPYLALSKTYNVDRQVPDSAGTATAYL
CGVKANYQTIGVSAAARYNQCNTTRGNEVTSVMNRAKKAGKSVGVVTTTRVQHASPAGTY
AHTVNRNWYSDADMPDEALKEGCQDIATQLISNMDIDVILGGGRKYMFPKGTPDPEYPND
ASQNGTRVDQRNLVQEWLAKYQGAQYVWNRTALIQASQDPSVTHLMGLFEPEDMQYEAHR
DLTLDPSLTEMTEAALRVLSRNPSGFYLFVEGGRIDHGHHAGTAYLALTEATMFDDAIDK
ASQLTSEEDTLTLVTADHSHVFSFGGYTLRGSSILGLAPSKASDGKAYTSILYGNGPGYV
LSGGSRPDVNESQSMDPAYKQQAAVPLSSETHGGEDVAVFARGPQAHLVHGVQEQTFVAH
VMAFAACLEPYKACDLSPPAAPTAAAPAGPAAGLLSLSLPPGLLLLLLLLLVSTAP
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atgcggggagcctgggtgctgttgctgctgcttggcctgaggctacggctctcccttggg
gtcatcccagttgaggaggaggacccggccttctggaaccgccaggcagcccaagccctg
gacaccgctaagaagctgcagcccatccagacggccgccaagaacctcattatcttcttg
ggggacgggatgggggtgcccacggtgacagccactcggatactgaaggcgcagatggat
ggcaagctgggacccgagacgcccctggccatggaccacttcccctacctggctctgtcc
aagacatacaacgtggacagacaagtgccggacagcgcaggcacagccacggcctacctg
tgcggggtcaaggccaactaccagaccatcggtgtgagtgcggccgcccgctataaccag
tgcaacacgacgcgtggcaatgaggtcacctccgtgatgaatcgagccaagaaagcaggg
aagtcagtgggggtggtgaccaccaccagggtacagcatgcgtcgccagccggcacctac
gcgcacacggtgaaccgcaactggtactcggacgctgacatgcctgacgaggcgctgaag
gagggctgccaggacatcgccacgcagctcatctccaacatggacattgatgtgatcctg
ggcggaggccgcaagtacatgtttcccaaggggaccccagaccctgagtatccgaatgat
gccagccagaacggaaccagggtggaccagcggaacctggtgcaggagtggctggccaag
taccagggtgcccagtatgtgtggaaccgcacggcgctcatccaggcgtcccaggacccc
tctgtgacacacctcatgggcctctttgagccagaggacatgcaatatgaggcccatcga
gacctcaccctggacccatccctgacggagatgaccgaggcagccctgcgtgtgctgagc
aggaaccccagtggcttctacctcttcgtggaggggggccgcatcgaccatggtcaccat
gctggaaccgcttacctggcgctgaccgaggccaccatgttcgatgatgccattgacaaa
gccagccagctcacaagtgaggaggacacactgacccttgtcaccgctgaccactctcac
gtcttctcttttggtggctacacactgcgtgggagctccattttagggctggcccccagc
aaggcctccgatggcaaggcctacacctccatcctgtatggcaatggcccaggctatgtg
ctcagtggtggttcccggcctgacgtcaacgagagccagagcatggaccccgcgtacaag
cagcaggcggccgtgcccctgtcgtcggagacccacggcggcgaggacgtggcggtgttc
gcgcgcggcccgcaggcgcacctggtgcacggcgtgcaggagcagaccttcgtggcgcac
gtcatggccttcgccgcctgtctagagccctacaaggcctgcgacctgtcgcccccggcc
gctcccactgccgctgcgcccgccgggccagctgctggcttgctgtcgctgtcgctgcct
ccagggctgctactgctgctgctgctgctgctggtatccactgcgccctga

DBGET integrated database retrieval system