KEGG   Equus caballus (horse): 100064801Help
Entry
100064801         CDS       T01058                                 

Gene name
ACE
Definition
(RefSeq) angiotensin-converting enzyme isoform X2
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
ecb  Equus caballus (horse)
Pathway
ecb04614  Renin-angiotensin system
ecb04924  Renin secretion
ecb05142  Chagas disease (American trypanosomiasis)
ecb05410  Hypertrophic cardiomyopathy (HCM)
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    100064801 (ACE)
   04614 Renin-angiotensin system
    100064801 (ACE)
 09160 Human Diseases
  09165 Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    100064801 (ACE)
  09167 Infectious diseases
   05142 Chagas disease (American trypanosomiasis)
    100064801 (ACE)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:ecb01002]
    100064801 (ACE)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ecb04147]
    100064801 (ACE)
   04090 CD Molecules [BR:ecb04090]
    100064801 (ACE)
Enzymes [BR:ecb01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     100064801 (ACE)
Peptidases [BR:ecb01002]
 Metallo Peptidases
  Family M2
   100064801 (ACE)
Exosome [BR:ecb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100064801 (ACE)
CD molecules [BR:ecb04090]
 Proteins
  100064801 (ACE)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M2
Motif
Other DBs
NCBI-GeneID: 100064801
NCBI-ProteinID: XP_001495639
Ensembl: ENSECAG00000012910
UniProt: J7ILL4
LinkDB All DBs
Position
11
AA seq 1313 aa AA seqDB search
MGAASGRRGPEPPPPPLPPLLLLLPLLLPPPPPTLALDPALQPGNFTADEAGAQLFAQSF
NSSAEQVLFQSSAASWAYVTNITQENARRQEDAALLNQEFAEVWGQKCKELYDPIWQNFT
DPILRRVISGVRILGPANLPLKKRQQYNSLLSNMNRIYSTAKVCYPNKTATCWSLDPELT
NILAVSRSYALLLYAWEGWHNTVGIPLKPLYQDFTALSNEAYKLDGFSDTGAYWRSWYES
PTFMEDLEHLYHQLEPLYLNLHAYVRRALHRRYGDRYINLRGPIPAHLLGDMWAQSWDNI
YDMVVPFPDKPNLDVTSAMVQKGWNATHMFWVAEEFFTSLGLLPMPPEFWAESMLEKPSD
GREVVCHASAWDFYNRKDFRIKQCTRVTLEQLSTVHHEMGHVQYYLQYKDQPVSLRQGAN
PGFHEAIGDVLALSVSTPTHLYKIGLLDRVTNDTESDINYLLKMALEKIAFLPFGYLVDQ
WRWGVFSGRTPPSRYNFDWWYLRTKYQGICPPVLRNETHFDAGAKFHVPNVTPYIRYFVS
FILQFQFHQALCKEAGHQGPLHQCDIYQSTQAGAKLRELLQAGSSRPWQEVLKDMIGSDA
LDAQPLLNYFQPVSQWLQEQNQQNDEVLGWPEYQWYPPMPDNYPESIELVSDEAEASKFV
EEYDRRSQVVWNEYAEANWNYNVNITTEASKILLQQNIQMANHTVKYGTWARQFDVTNFQ
NTTMKRMIKKIQDLERAALPVKELQEYNKILLDMETTYSVASVCLANGTCLQLEPDLTNL
MATSRKYEELLWAWQGWRDNVGRSILPFFPKYVELFNKAARLNGYVDAGDSWRSMYEMPS
LEQDLEQLYQELQPLYLNLHAYVRRALHRHYGPQHVNLEGPIPAHLLGNMWAQTWSNIYD
LVVPFPSAPKMDATEAMIKQGWTPRRMFEEADNFFTSLGLLPVPPEFWNKSMLEKPTDGR
EVVCHASAWDFYNGKDFRIKQCTAVNMEDLVVAHHEIGHIQYFMQYKDLPVTFREGANPG
FHEAIGDVLALSVSTPKHLYNINLLSSEGGGYEQDINFLMKMALDKIAFIPFSYLVDQWR
WRVFDKSITKENYNQEWWSLRLKYQGLCPPVARSQGDFDPGAKFHIPSSVPYIRYFVSFV
IQFQFHEALCQAAGHKGPLHKCDIYQSKEAGKRLADAMKLGFSKPWPEAMKLITGQPNMS
ASAMMNYFKPLLDWLLTENGRHGEKLGWPQYNWTPNSARSEASFLGTGRVNFLGLNLEEQ
QARVGQWMLLFLGVALLVATLGLTQRLFSIRQYSLRQPHRGPQFCSEVELRRS
NT seq 3942 nt NT seq  +upstreamnt  +downstreamnt
atgggggccgcgtcgggccgccgggggccggagccaccgccgccaccgctgccgccgctg
ctgctgctgctgccgctgctgctgccaccgccgccgcccaccctggcactcgaccccgcg
ctgcagcccggaaactttaccgcggacgaggccggggcgcagctcttcgcgcagagcttc
aactcgagcgccgagcaggtgctgttccagagctcggccgccagctgggcgtacgtcacc
aacatcacccaggagaacgcgcggcgccaggaggacgcagccttgctcaaccaggagttt
gccgaggtctggggccagaagtgcaaggagctgtacgacccaatctggcagaacttcacc
gacccgatattgcggagggtcatcagtggtgtgcgcatcctgggccctgccaacctgccc
ctgaagaagcggcagcagtacaactctctgctaagcaacatgaacaggatctactccact
gccaaggtctgctaccccaacaagactgccacctgctggtccctggacccagagctcacc
aacatcctggctgtctctcgaagctatgccttgctgctctatgcctgggaaggctggcac
aacactgtgggcatcccgctgaaacccctgtaccaggacttcactgccctcagcaatgag
gcctacaagctggatggcttctcagacacaggggcctactggcgctcctggtatgagtcg
cccaccttcatggaggatctggagcacctctaccatcaattagagcccctctacctcaac
ctgcatgcctacgtccgccgcgcactgcaccgccggtacggggacagatacatcaacctc
aggggacccatccctgctcacttgctgggggacatgtgggctcagagctgggacaacatc
tacgacatggtggtgcctttccctgacaagcccaatctcgacgttaccagtgctatggtg
cagaagggctggaatgctacgcacatgttctgggtggccgaggaattcttcacttccctg
gggctcttgcccatgcctcctgagttttgggcagagtctatgctggagaaaccaagcgac
gggcgtgaagtggtttgccacgcttctgcctgggacttctacaacagaaaagacttcagg
atcaagcagtgcacacgggtcactctagagcagctgtccacggtgcaccacgagatgggc
cacgtgcagtactacttgcagtacaaggaccagcccgtctccctgcgccaaggcgccaat
cctggcttccacgaggccatcggagatgtgctagcactgtctgtctccacccctacacat
ctgtacaaaattggcttgctggaccgtgtcaccaatgacacggaaagcgacatcaattac
ttgttaaagatggcactggaaaaaattgccttcctgccgtttggctacttggtggaccaa
tggcgttggggggtctttagtgggcgtacccccccttcccgctacaactttgactggtgg
tatcttcgaaccaaatatcaggggatctgtcctccagttctccgaaacgaaacccacttt
gatgctggagcaaagtttcatgtcccaaatgtgacaccgtacatcaggtactttgtgagt
tttatcctgcagttccagttccatcaagccctgtgcaaggaggcaggccaccagggccca
ctgcaccagtgtgacatctaccagtccacccaggcgggggccaagctccgggagttgctg
caggcaggctcctcacggccctggcaagaggtgctgaaggatatgattggctcagatgcc
ctggacgctcagccactgctcaactacttccagccggtcagccagtggctacaggagcag
aaccagcagaatgacgaggtcctaggctggccagagtatcagtggtacccaccgatgccc
gacaattacccagagagcattgagctggtgagtgatgaggctgaggccagcaagtttgtg
gaggaatatgaccggagatcccaagtggtgtggaacgaatatgccgaggccaactggaac
tacaacgttaacatcaccacagaggccagcaagatcctgctgcagcagaacatacagatg
gcaaaccacactgtcaagtatggcacctgggccaggcagtttgatgtgaccaacttccag
aataccaccatgaagcggatgataaagaagattcaggacctagagcgggcagcgctgcct
gtcaaggagctgcaggagtacaacaagatcctgctggacatggaaactacttacagcgtg
gcctctgtgtgcctcgccaatggtacttgtctacagctagagcctgatctgacgaatctg
atggccacatcccggaaatatgaagaactgttgtgggcatggcagggctggcgagacaat
gtggggaggtccatcctccctttttttccaaaatacgtggagctcttcaacaaggctgcc
cggctcaatggctatgtagacgcaggggactcgtggagatctatgtacgagatgccgtcc
ctggagcaagacctggagcagctctaccaggagctgcagccgctctacctgaacctgcac
gcctacgtgcgccgggccctgcaccgccactacgggccacaacacgtcaacctggagggc
cccattccagctcatctcctggggaacatgtgggcgcagacctggtccaacatctatgac
ttggtggtgcctttcccttcagcccccaagatggatgccacagaagccatgataaagcag
ggctggacacccagaaggatgtttgaggaagcggacaatttcttcacctccctgggactg
ctgcctgtgccccctgagttctggaacaagtccatgctagagaagccaactgatggacgg
gaggtggtatgccatgcctctgcctgggacttctacaatggcaaagacttcaggatcaag
cagtgcactgctgtgaatatggaggacctggtggtggctcaccacgaaataggccacata
cagtatttcatgcagtacaaggacttgcctgtgaccttccgggagggtgccaaccctggc
tttcatgaggccattggggacgtgctggcactctcagtgtctacccccaagcacctatac
aacatcaacctgctgagtagcgagggtggtggctacgagcaagatatcaactttctgatg
aagatggcactcgacaagattgcctttatcccgttcagctaccttgttgaccagtggcgc
tggagagtgtttgacaaaagcattactaaggagaattacaaccaggaatggtggagcctc
aggctgaagtaccagggcctctgccctccagtagccaggtctcaaggtgactttgaccca
ggggccaaattccacattccttcaagtgtgccttatatcaggtactttgtcagctttgtc
atccagttccaattccacgaggcactgtgtcaggcagctggccacaagggccccctacac
aagtgtgacatctaccagtccaaggaggcagggaagcgcctggcggacgccatgaagctg
ggcttcagtaagccatggcccgaagccatgaagctaatcacgggccagcccaacatgtca
gcctcagccatgatgaactacttcaagccgctgctggactggctcctcactgagaacggg
cggcacggggagaagctgggatggccacagtacaactggacaccaaactctgctcgctcg
gaagcctccttcctgggcaccggccgtgtcaacttcctgggcttgaacctggaggagcag
caggcccgtgtgggccagtggatgctgctcttcctgggcgtcgccctgctggtggccacc
ttgggtctcacccagcggctcttcagcatccgccagtacagcctccgccagcctcaccgt
gggccccagttctgctccgaggtggagctgagacgctcctga

DBGET integrated database retrieval system