KEGG   Equus caballus (horse): 100064836
Entry
100064836         CDS       T01058                                 

Gene name
KL
Definition
(RefSeq) klotho
  KO
K14756  klotho [EC:3.2.1.31]
Organism
ecb  Equus caballus (horse)
Pathway
ecb00040  Pentose and glucuronate interconversions
ecb00053  Ascorbate and aldarate metabolism
ecb01100  Metabolic pathways
ecb04211  Longevity regulating pathway
ecb04928  Parathyroid hormone synthesis, secretion and action
ecb04961  Endocrine and other factor-regulated calcium reabsorption
Module
ecb_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    100064836 (KL)
   00053 Ascorbate and aldarate metabolism
    100064836 (KL)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    100064836 (KL)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    100064836 (KL)
  09149 Aging
   04211 Longevity regulating pathway
    100064836 (KL)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ecb02000]
    100064836 (KL)
   04147 Exosome [BR:ecb04147]
    100064836 (KL)
Enzymes [BR:ecb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.31  beta-glucuronidase
     100064836 (KL)
Transporters [BR:ecb02000]
 Other transporters
  Accessory factors involved in transport [TC:8]
   100064836 (KL)
Exosome [BR:ecb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100064836 (KL)
SSDB
Motif
Pfam: Glyco_hydro_1
Other DBs
NCBI-GeneID: 100064836
NCBI-ProteinID: XP_001495662
Ensembl: ENSECAG00000008185
VGNC: 19435
LinkDB
Position
17
AA seq 1011 aa
MPARAPPRRPRPPPLPLPLLLLLALGGRRLRAEPGDGAQTWARFARPPAPEAAGLLHGTF
PDGFLWAVGSAAYQTEGGWRQHGKGASIWDTFTHHPPATPGGPQLSGLPSGGPSPSPLAT
GDVASDGYNNVFRDTEGLRELGVTHYRFSISWARVLPNGSAGAPNREGLRYYRRLLERLR
ELGVQPVVTLYHWDLPQRLQDAYGGWANRALADHFRDYAELCFRHFGGQVKYWITIDNPY
VVAWHGYATGRLAPGVRGSPQLGYLVAHNLLLAHAKIWHLYNTSFRPTQGGQVSIALSSH
WINPRRMTDHSIKECQKSLDFVLGWFAKPIFIDGDYPETMKNNLSSLLPDFTESEKKFIK
GTADFFALSFGPTLSFQLLDPHMKFRQLESPSLRQLLSWIDLEYNHPQIFIVENGWFVSG
TTKRDDAKYMYYLKKFIMETLKAIRLDGVDVIGYTAWSLMDGFEWHRGYSIRRGLFYVDF
LSQDKKLLPKSSALFYQKLIEKNGFPPLPENQPLEGTFPCDFAWGVVDNYIQVDTTLSQF
TDPNVYLWDVHHSKRLIKVDGLVAKKRTSYCVDFAAIRPQIALLQEMHVSHFHFALDWPL
ILPLGNQSQVNRTGLHYYRCVVSELVRANITPVVALWRPSPQHQGLPRLLAKHGAWENPH
TALAFAEYARLCFQELGHHVKFWITMSEPYTRNMTYSAGHNLLKAHALAWRVYDDKFRHA
QKGKISIALQADWIEPACPFSQQDKEGAERVLEFDIGWLAEPIFGSGDYPPVMRDWLNQR
NNFLLPYFSEEEKKLIRGSFDFLALSHYTTILVDWEKEDPMKYNDYLEVQEMTDITWLNS
PSQVAVVPWGLRKVLNWLKSKYGDLPMYIIANGIDDDPQEAQDRLRVYYMQNYVNEALKA
YVLDGINLCGYFAYSFNDRTAPKFGLYRYAANQFEPKPSMKHYRKIIDNNGFPGPKTLGR
FCPEEFTLCTECSFFHTRKSLLAFIAFLLFAFIISLSLIFYYSKKGRRNYK
NT seq 3036 nt   +upstreamnt  +downstreamnt
atgcccgcccgcgccccgccacgccgcccgcggccgccgccgctgccgctgccgctgctg
ctgctgctggccctgggcggccgccgcctgcgcgccgagcccggcgacggtgcgcagacc
tgggcccgcttcgcgcgccccccggcccccgaggccgcgggcctgctccacggcaccttc
cccgacggcttcctctgggccgtgggcagcgccgcctaccagacggagggcggctggcgg
cagcacggcaagggcgcgtccatctgggacacgttcacccaccaccccccggcgacccca
ggcggcccccagctgtccggcctgccgtcgggcggcccctcgccgtcccctcttgccacc
ggggacgtggccagcgacggctacaacaacgtcttccgagacacggaggggctgcgcgag
ctcggggtcacccactaccgcttctccatctcgtgggcgcgggtgctccccaatggcagc
gcgggcgccccaaaccgcgaggggctgcgctactaccggcgcctgctggagcggctgcgg
gagctgggcgtgcagcccgtggtcaccctgtaccactgggacctgccccagcgcctgcag
gacgcctatggcggctgggccaaccgtgccctggccgaccacttcagggattacgccgaa
ctctgcttccgccacttcggaggccaggtcaagtactggatcaccatcgacaacccctat
gtggtggcctggcacggctatgccacagggcgcctggcccctggcgtccggggcagcccg
cagctcgggtatttggtggcgcacaacctcctcctggctcatgccaaaatctggcatctc
tacaatacttctttccgtccgactcagggaggccaggtgtccattgccctaagctcccac
tggatcaatcctcgaagaatgaccgaccatagcatcaaagaatgtcaaaaatctcttgac
tttgtactaggctggtttgccaaacccatatttattgatggtgactatcccgagaccatg
aagaataatctttcctctcttctgcctgattttaccgaatctgagaaaaagttcatcaag
ggaacagctgacttttttgctctttcctttgggccgaccctgagttttcaactcttggac
cctcacatgaagttccgccaattagaatctcccagcctgaggcaactcctttcctggatt
gaccttgaatataaccatcctcaaatatttattgtggaaaatggctggtttgtctcaggg
accaccaagagagatgacgccaaatatatgtattacctcaaaaaattcataatggaaact
ttaaaagccatcaggctggatggggtggacgtcatcgggtacacggcgtggtccctcatg
gacggcttcgagtggcacagaggctacagcatccgacgtggactcttctatgtcgacttc
ctgagccaggataagaaattgttgccgaagtcttcagccttgttctaccaaaagctgata
gagaaaaacggcttccctcctttacctgaaaatcagcccctagaagggacatttccctgt
gactttgcttggggagttgttgacaactacattcaagtcgacaccactctctctcagttt
accgacccaaacgtttacctgtgggatgtccaccacagtaagaggctcattaaggtggac
gggcttgtggccaagaagaggacatcctattgtgttgactttgctgccatccggccccag
attgccttactccaggagatgcacgtttcgcattttcacttcgccctggactggccgctc
atcctcccgctggggaaccagtcccaggtgaaccgcaccggcctgcactactatcgctgc
gtggtcagcgagctcgtgcgcgccaacatcacccccgtggtggcgctgtggcggccttcc
ccccagcaccaaggactgccgcgcctcctggccaagcacggcgcctgggagaacccccac
accgccctggcctttgcagagtacgccagactgtgcttccaagagctcggccaccacgtc
aagttctggatcacgatgagcgagccgtacacgcggaacatgacgtacagcgcggggcac
aatctcctgaaggcccacgccttagcttggcgcgtgtatgatgacaagtttaggcacgct
cagaaaggcaaaatatctatagccttgcaggctgattggatagaaccggcctgccctttc
tcccaacaggacaaagaaggggcggagagagttctggaatttgacattggctggctggcc
gagcccattttcggctctggagattatccgcctgtgatgagggactggctgaaccaaaga
aacaacttccttctaccttatttcagtgaagaggaaaaaaagctgatccggggttccttt
gactttttggctttgagccattacaccaccatccttgtggactgggaaaaagaagatcca
atgaaatataacgattacctggaagtgcaggaaatgaccgacatcacctggctcaactct
cccagtcaggtggcagtagtgccctgggggttgcgcaaggtactgaactggctaaagtcg
aagtatggagacctccccatgtatataatagccaacggcatcgatgatgacccccaggaa
gcccaagacaggctgagagtgtattatatgcagaattatgtaaatgaagctctgaaagcc
tacgtgttggatggtatcaatctttgcggatactttgcttattcatttaacgatcgcacg
gctccgaagtttggcctttatcgttatgccgcaaatcagtttgagcccaaaccttccatg
aaacattacaggaaaattatcgacaacaatggctttccaggtcccaaaactctgggaaga
ttttgtccggaagagttcaccctgtgcaccgagtgcagcttttttcacacccgaaagtcc
ttactggctttcatagcttttctattgtttgcttttattatttctctctctcttattttt
tactactctaagaaaggcagaagaaattacaaatag

DBGET integrated database retrieval system