KEGG   Equus caballus (horse): 100064886Help
Entry
100064886         CDS       T01058                                 

Gene name
PCSK1
Definition
(RefSeq) neuroendocrine convertase 1
  KO
K01359  proprotein convertase subtilisin/kexin type 1 [EC:3.4.21.93]
Organism
ecb  Equus caballus (horse)
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:ecb01002]
    100064886 (PCSK1)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:ecb03110]
    100064886 (PCSK1)
Enzymes [BR:ecb01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.93  proprotein convertase 1
     100064886 (PCSK1)
Peptidases [BR:ecb01002]
 Serine Peptidases
  Family S8: subtilisin family
   100064886 (PCSK1)
Chaperones and folding catalysts [BR:ecb03110]
 Intramolecular chaperones
  Subtilisin family
   100064886 (PCSK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_S8 P_proprotein S8_pro-domain Proho_convert OmpA_membrane Peptidase_S8_N
Motif
Other DBs
NCBI-GeneID: 100064886
NCBI-ProteinID: XP_001504658
Ensembl: ENSECAG00000020422
VGNC: 21216
UniProt: F6TCF0
LinkDB All DBs
Position
14
AA seq 754 aa AA seqDB search
MERRAWTLQCTAFALFCAWCALNSVKAKRQFVNEWAAEIPGGPEAASAIAEELGYDLLGQ
IGSLENHYLFKHKNHPRRSRRSAFHITKRLSDDDRVIWAEQQYEKERSKRSILRDSALNL
FNDPMWNQQWYLQDTRMTAALPKLDLHVIPVWQKGITGKGVVITVLDDGLEWNHTDIYDN
YDPEASYDFNDNDHDPFPRYDPTNENKHGTRCAGEIAMQANNHKCGVGVAYNSKVGGIRM
LDGIVTDAIEASSIGFNPGHVDIYSASWGPNDDGKTVEGPGRLAQKAFEYGVKQGRQGKG
SIFVWASGNGGRQGDNCDCDGYTDSIYTISISSASQQGLSPWYAEKCSSTLATSYSSGDY
TDQRITSADLHNDCTETHTGTSASAPLAAGIFALALEANPNLTWRDMQHLVVWTSEYDPL
ANNPGWKKNGAGLMVNSRFGFGLLNAKALVDLADPRTWSSVPEKKECVVKDNDFEPRALT
ANGEVIIEIPTRACEGQENAIKSLEHVQFEATIEYSRRGDLHVTLTSAAGTSTVLLAERE
RDTSPNGFKNWDFMSVHTWGENPIGTWTLRITDMSGRMQNEGRIVNWKLILHGTSSQPEH
MKQPRVYTSYNTVQNDRRGVEKMVDSGEEQPTQENLTTNPLASKSPSGSSSVGGRRAELA
EGAPSEAMLRLLQSAFSKNPAAQQSPKKSPSAKLNIPYENFYQALEKLNKPSQLKDSEDS
LYNDYVDVFYNTKPYKHRDDRLLQALVDILREEN
NT seq 2265 nt NT seq  +upstreamnt  +downstreamnt
atggagcgaagagcctggactctgcagtgtactgctttcgctctcttttgcgcttggtgt
gcattgaacagtgtaaaagcaaagaggcagtttgtgaatgaatgggcggcggaaatcccc
gggggaccggaggcagcctcggccatagccgaggagctgggctatgaccttttgggtcag
ataggatcacttgaaaatcactatttattcaaacataaaaaccatccccgaagatctcga
aggagtgcctttcatatcaccaagagattatctgatgatgatcgtgtgatatgggctgaa
caacagtatgaaaaagagagaagtaaacgttcaattctaagagactcagcactaaatctc
ttcaatgatccaatgtggaatcagcagtggtacttgcaagatactaggatgaccgcagcc
ctgcccaaactggacctccatgtgatacctgtttggcaaaaaggcatcacaggcaaagga
gttgttatcactgtactggatgatggcctggagtggaatcacacagacatctatgacaat
tatgatccagaggctagctatgattttaacgataatgaccatgatccatttcccagatat
gatcccacaaatgagaacaaacatgggaccagatgcgcaggagaaattgccatgcaagca
aataatcacaagtgcggggttggagttgcatacaattccaaagtcggaggcataagaatg
ctggatggcattgtgactgatgctattgaagccagttcaattggattcaatcctggacat
gtggatatttacagtgccagttggggcccaaacgatgatgggaaaactgtggaagggccc
ggccgattagcccagaaggcttttgaatatggtgtcaaacaggggagacaaggaaagggt
tccatcttcgtctgggcttccgggaatggggggcgtcagggagataactgtgactgtgat
gggtacacggacagcatctacaccatctccatcagcagtgcctcgcagcaaggcctgtcc
ccctggtatgctgagaagtgctcctccacgctggccacctcctacagcagcggcgattac
accgaccagagaatcacgagcgccgacctgcacaatgactgcacagagacccacacgggc
acctcggcctcagcacccctggctgctggcatcttcgctctggccctggaagcaaatcca
aatctcacctggcgagatatgcagcacctggttgtctggacctctgagtatgacccactg
gccaataaccccggatggaaaaagaatggagcaggcttgatggtgaatagtcgatttgga
tttgggttgctaaatgccaaagctctggtggatttagctgatcccaggacctggagcagt
gtgcctgagaagaaagagtgtgttgtgaaggacaatgactttgagcccagagccttgaca
gctaatggagaagttatcattgaaattccaacaagagcttgtgaaggacaagaaaatgct
atcaagtccttggaacatgtgcaatttgaagcaacaattgaatattcccgcagaggagat
cttcatgtcacactcacttctgctgctggaaccagcactgtactgttggctgaaagagag
cgggatacatctcctaatggctttaagaactgggacttcatgtctgttcacacgtgggga
gaaaatcccatcggtacctggactttgcgaattacagacatgtctggaagaatgcaaaac
gaaggaagaatcgtgaactggaagctgattttgcatgggacctcttctcagccagaacac
atgaaacagcctcgtgtatatacatcctacaacaccgttcagaatgacagaagaggggtg
gagaagatggtggattcgggcgaggagcagcccacacaagagaacctgaccacgaacccc
ctggcgtcaaaaagccccagcggcagcagcagcgttgggggcagaagggccgagctagcc
gagggagccccgtccgaggccatgctgcgactcttacagagcgctttcagcaaaaaccca
gccgcacagcaatcaccaaagaagtcgccaagtgcaaagctcaacatcccttacgaaaat
ttctaccaagccctggaaaagctgaacaaaccttcccagcttaaagactctgaggacagt
ctgtataacgactatgtggatgttttctacaacacgaaaccttacaagcacagagatgac
cggctgctgcaagctctggtcgacattctgagggaggaaaattaa

DBGET integrated database retrieval system