KEGG   Equus caballus (horse): 100064888Help
Entry
100064888         CDS       T01058                                 

Gene name
SETD2
Definition
(RefSeq) histone-lysine N-methyltransferase SETD2 isoform X1
  KO
K11423  histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
ecb  Equus caballus (horse)
Pathway
ecb00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    100064888 (SETD2)
Enzymes [BR:ecb01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100064888 (SETD2)
Chromosome and associated proteins [BR:ecb03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     100064888 (SETD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SRI SET AWS WW
Motif
Other DBs
NCBI-GeneID: 100064888
NCBI-ProteinID: XP_023476312
Ensembl: ENSECAG00000009721
VGNC: 22874
LinkDB All DBs
Position
16
AA seq 2563 aa AA seqDB search
MKQLPPQPPPKMGDFYDPEHPTPEEEENEAKIENVHKTGFIKGPMFKGVASSRFLPKGTK
TKVNLEEQGRQKVSFSFSLTKKTLQNRFLTALGNEKQNDAQNSPTAPLQADLTPKIKMDI
GDTLSTTEESSPPKSRVELGKIHFKKHLLHVTSRPLPTTLTAVASPPPPIVPLPAVIAES
TTVDSPPLSPPPPPPPPQTTTSSPPAAITEPVALPHTPITVLMTAPGDVAVRALKEPSVT
VVPESSEVDTKQDTVSNSSEEHITQNLNEQADIPSQREDSHIGKEEEIPDSSKSSLGSKK
TVSKKKSSQSEGTFFGSESDEDSVRTSSSQRSHDLKFSANIEKERDSKKSLAPLKSEDLG
KSSRSKTERDDKYFSYSKLERDTRYISSRCRSERERRRSRSRSRSDRGSRTSLSYSRSER
SHYYDSDRRYHRSSPYRERARYSRPHTDNRARESSDSEDEYKKTYSRRTSSHSSYRDPRT
SSSYSKSDRDCKTESSYLEMEKRGKYSSKLERESKRTSENEAMKRCCSPSNELGFRRGSS
YSKHDNSVSRYKSTPSKSIPKSDKFKNSFCCTELNEEIKQSHSFSLQTPCSKGSELRMIS
KIPEREKTGSPSPSNRLNDSPTFKKLDESPIFKSEFIGHDSHDSNKELDSLSKVKSDQLR
SYCPIESNINGSPGAESDLATFCTSKTDTVLMSSDDSVTGSEISPLVKACMLSSNGFQNI
SKCKEKDLDDTCMQHNKSESSFRETEPPLSPDQDKLMSLPIMTIDYSKTVAKEPVDMRVS
CCKTKDSDIYCTSNDSNPSLCHSEAENIEPSVAKISSNSFMNVHLKSKTVIRDSRNLTDQ
HSKLAYEEYKQIVGSTSSASVNHFDDLYQPIESSGIASSLQSLSPGIKVDNLTLLQCVEN
TPSVLDAVPKSKTTEFLKYAEKETIVEVDSGLPHSGRGFASWENRHNNGLSGKCVQEAQE
EGNSILPDRRRRPEISLDEEGGRGHAHTSDDSEVVFSSCDLNLTMEDSDSVTYTLKCDSS
GHASEIVSTVHEDYSGSSESSSDESDSEDTDSDDSSIPRNRLQSVVVVPKNSTLPMEETS
PCSSRSSQSYRHYSDHWEDERLESRRYSYEEKFESIASKACSLTEKFFLHKGIEKNPEIS
FTQPSRKQIDNHLPEIAHPQSDGVDSTSHTDVKSDPLGHLNSEETMKAKIASRQQEELPL
YSSDDFEDVPNKSRQQTTFPNRPDSRLGKTELSFSSCCEISRVDGFHSSEELRNLGWDFS
QQEKPTTTYQQPDSSYGACGGHKYQQSAEQYGGARSYWQGNGYWDPRSAGRPPGTGVVYD
RIQGQVPDSLTDDREEEENWDQHGGSHFSSQSNKFFLSLQKDKGSVQAPEISSNSIKDSL
AVSEKKDLSKNLEKSDMKDRGPPKKRRQELESDSESDGELQDRKKVRMEVEQGETAVPPG
SALVGPSCVMEDFRDPQRWKECAKQGKMPCYFDLIEENVYLTERKKNKSHRDIKRMQCEC
TPLSKDERAQGEIACGEDCLNRLLMIECSSRCPNGDYCSNRRFQRKQHADVEVILTEKKG
WGLRAAKDLPSNTFVLEYCGEVLDHKEFKARVKEYARNKNIHYYFMALKNDEIIDATQKG
NCSRFMNHSCEPNCETQKWTVNGQLRVGFFTTKLVPSGSELTFDYQFQRYGKEAQKCFCG
SANCRGYLGGENRVSIRAAGGKMKKERSRKKDSVDGELEALMENGEGLSDKNQVLSLSRL
MVRIETLEQKLTCLKLIQNTHSQSCLKSFLERHGLSLLWIWMAELGDGRESNQKLQEEII
KTLEHLPIPTKNMLEESKVLPIIQRWSQTKTAVPQLSEGDGYSSENTSRAQTPLNTPDPS
TKLTTEADTDTPKKLMFRRLKIISENSMDSAISDATSELEGKDGKEDLDQLENVPVEEEE
ELQSQQLLTQQLPESKVDSEIAMEASKLPMSETEADTEIEPKENNGTKLEEPIAEETPSQ
DEEEGVSDVESERSQEQPDKTVDISDLATKLLDSWKDLKEVYRIPKKSQTEKENTITERG
RDAVGFRDQTAAPKTPNRSRERDPDKQTQNKEKRKRRGSLSPPSSAYERGTKRPDDRYDT
PTSKKKVRIKDRNKLSTEERRKLFEQEVAQREAQKQQQQMQNLGMTSPLPYDSLGYNAPH
HPFAGYPPGYPMQAYVDPSNPNAGKVLLPTPSMDPVCSPAPYDHSQPLVGHSTEPLAAPP
PVPVVPHVATPVEVSSSQYVAQSDGVVHQDSSVAVLPVPAPGPVQGQNYGVWDSNQQSVS
VQQQYSPAQSQATIYYQGQTCPTVYGVTSPYSQTTPPIVQSYAQPSLQYIQGQQIFTAHP
QGVVVQPAAAVTTIVAPGQPQPLQPAEMVVTNNLLDLPPPSPPKPKTIVLPPNWKTARDP
EGKIYYYHVITRQTQWDPPTWESPGDDASLEHEAEMDLGTPTYDENPMKTSKKPKTAEAD
TSSELAKKSKEVFRKEMSQFIVQCLNPYRKPDCKVGRITTTEDFKHLARKLTHGVMNKEL
KYCKNPEDLECNENVKHKTKEYIKKYMQKFGAVYKPKEDTELE
NT seq 7692 nt NT seq  +upstreamnt  +downstreamnt
atgaagcagctgccgccgcagccgcctccgaagatgggggatttctacgaccccgagcac
ccgacccctgaagaagaagaaaatgaggcaaagattgaaaatgtgcataaaacgggtttc
atcaaaggaccaatgttcaaaggtgttgcctctagtcgatttttgcccaaaggcaccaaa
acaaaagttaatttggaggaacagggacgacagaaggtgtcattcagcttcagccttaca
aagaaaactttgcagaacagatttctgactgcacttggcaatgaaaagcaaaatgatgct
cagaactccccaactgcacctcttcaagcagacttgacccctaaaattaaaatggacatt
ggagataccttatctactacagaagaatcttccccaccaaaatcaagagtagaattgggc
aaaattcattttaagaagcatctgcttcatgtaacatccaggccactgccaactactctg
acagcagtggcatctccacctcctcccatagtaccgttaccagcagtcatagcagaatca
acaactgtagactcgccacccttgtctccacctccaccacctccacctccccaaaccaca
acgtcctcaccaccagcagcaataacagagccagtggccttgccacacacaccaataaca
gttctgatgacagcaccaggagatgtagcagttagagccctgaaggagccatcagttaca
gttgtaccagaatcttcagaagtggacactaagcaggacactgtgtctaatagttcagaa
gagcacataactcaaaatttgaatgagcaagcagatattccctcacaaagagaagattcc
catattgggaaggaagaagaaattccagatagttcaaagagtagtctgggctctaaaaaa
acagtttctaagaagaaatcctcacaatctgaaggcaccttttttggttcagaatctgat
gaagattctgtaaggacttcctcaagtcaaagatcacatgatttaaaattttcagcaaac
attgaaaaagaaagagattcaaagaagagtttagcacctttaaaaagtgaggatttagga
aaatcttcacgatctaaaacagagagagatgataaatattttagctactcaaaacttgaa
agagatactcggtatatatcttctcgatgtagatcagagagagagcgaaggcggagtaga
tctcgttctagatctgacagaggctctagaactagtttatcctattcccggtcagaacga
tcccattattacgactctgatcgtcgctaccacaggagttccccttatcgagagagggca
cgctattctcggccacatacagataacagggcacgagaaagttctgactcagaagatgag
tataagaagacgtactcgaggcgcacctcatctcattcctcttacagagacccaaggaca
tcatcatcctattccaaatctgaccgggactgcaaaactgagtcctcttacttagagatg
gagaaaagaggaaagtattcttcaaaactagaaagagaatctaaaaggacttcagaaaat
gaagcaatgaaaagatgttgttctccctctaatgaactgggattccgacgggggtcatca
tattccaagcacgacaacagtgtttcccgttataaatctaccccttcaaaatctataccc
aagtctgataaatttaaaaattctttctgttgtacagaattgaatgaggaaattaaacag
tctcattcttttagtttacagactccttgttcaaaaggtagtgaattaagaatgattagt
aaaattcctgaaagagaaaagactggatctccatctccatcaaatcgattaaatgattca
cctacttttaaaaagctagatgaatcgcctatttttaagtctgaatttataggacacgat
agccatgatagtaataaggaattagattctttatctaaagtgaagagtgatcaattaaga
agttattgtcccatagaatcaaatataaatggatctcctggggcagaatctgatttggca
acattttgcacttctaaaactgacactgttttgatgtcttctgatgatagtgtgactgga
tcggagatatcgcctttggtcaaagcatgcatgctttcatcaaatggatttcagaatatt
agtaaatgtaaagaaaaagacttggatgatacttgcatgcagcataataagtcagaaagc
tcatttagagaaacagaacctccattgtcaccagaccaggataaactcatgtctttgcca
attatgactatagattattccaaaacagtagctaaagaaccagttgatatgagagtttct
tgctgtaaaaccaaagattcagatatatactgtacttcaaatgacagcaacccttctttg
tgtcattccgaagctgaaaacattgaaccttcagttgcgaagatttcttcaaatagcttt
atgaatgtgcatttgaaatcaaaaacagttatacgtgatagtagaaatctgacagatcaa
cactcaaaattggcatatgaagaatataagcagattgttggtagcactagttcagcttct
gttaatcattttgatgatttatatcaacctatagagagttcaggtattgcttcatctctt
cagagtctttcaccaggaataaaagtggacaatttaactctcttgcaatgtgtagagaac
acaccttcagttttggatgctgtgccgaagagtaaaaccacagagtttttaaagtatgca
gagaaagaaacaatagtagaagtagatagtggccttcctcattcaggaaggggatttgct
tcctgggaaaacaggcataataatgggttatctgggaaatgtgtgcaagaggctcaagaa
gaagggaattccatattgcctgatagaagaagaagaccagaaatctctttagatgaagaa
ggaggaagaggacatgcacatacttctgatgattcagaagttgtattttcttcttgcgat
ttgaatttaaccatggaagacagtgacagtgtaacatataccttaaaatgtgacagtagt
ggtcatgcctcagagattgtgtctactgtccatgaagattattctggttcttctgaaagt
tcaagtgatgaaagtgattcagaagatacagattctgatgatagcagtattccaagaaac
cgtcttcagtctgttgtggttgtgccaaagaactctactttgcccatggaagaaacaagc
ccttgttcttctcggagcagtcagagttacagacactattctgaccactgggaagatgag
agattggagtcaaggagatattcatatgaggaaaaatttgagagtatagctagtaaagcc
tgttctctaactgagaagttcttccttcataaaggaatagagaagaatccagaaatttct
tttacacagcccagcagaaaacaaatagataatcacctccctgaaattgctcaccctcag
agtgatggagttgatagtacaagtcatacagatgtgaaatctgaccctctaggtcatcta
aattctgaggaaacaatgaaagccaagatagcttctagacagcaagaagagctgccactt
tattcttctgatgattttgaagatgtcccaaataagtctcggcaacagaccactttccct
aataggccagatagtagactgggaaaaacagagttaagcttttcttcgtgttgtgagatc
tcccgagtggatggttttcattcatcggaagagctcagaaacctagggtgggacttctct
caacaagaaaagcctaccactacatatcagcagcctgacagcagctatggagcctgtggt
gggcacaagtaccagcaaagtgcagaacagtatggtggggcacgtagttactggcaaggc
aatggctactgggatccaagatctgcaggtagacctcctggaactggtgttgtgtatgat
cgaattcaagggcaggtaccagattccttaacagatgaccgtgaagaggaggagaattgg
gatcaacatggaggatctcacttttcaagccagtccaataaattttttctatcccttcag
aaggacaaggggtcagtgcaagcacctgaaataagcagcaattccattaaggactcttta
gcagtgagtgaaaagaaagatctttcaaaaaatttagaaaaaagtgatatgaaagataga
gggcctcctaaaaaaaggaggcaggaattggagagtgattctgaaagtgatggtgagctt
caggacagaaagaaagttagaatggaggtagagcagggagagacagcagtgcctccaggg
tcagcgctggttgggccttcctgtgtcatggaggacttcagggacccacagcgatggaag
gaatgtgccaagcaagggaagatgccttgttactttgatctgattgaagaaaatgtttat
ttaacagaaagaaagaagaataaatcgcatcgggatattaagcgaatgcaatgtgagtgt
acacctctttctaaagatgaaagagctcaaggtgaaatagcatgtggagaagattgtctt
aatcgtctcctcatgattgagtgttcttctcggtgtccaaatggggattattgttccaat
agacggtttcagagaaaacagcatgcagatgtggaagtcatactcacagaaaagaaaggc
tggggcttgagagctgccaaagaccttccttcgaacacgtttgtcctggaatattgtgga
gaggtacttgatcataaagagtttaaagcccgggtaaaggagtatgcacgaaacaaaaac
atccactactatttcatggccctgaagaatgacgagataatagatgccactcagaaagga
aattgctctcgtttcatgaatcacagctgtgaaccaaactgtgagactcaaaaatggact
gtgaatggacaactgagggttgggttttttaccaccaaactggttccttctggctcagag
ttaacgtttgactatcagttccaaagatatggaaaagaagctcagaaatgtttctgtggg
tcagctaattgccggggttacctgggaggagagaacagagtcagcatcagagcagcagga
gggaaaatgaagaaggaacgttctcgtaagaaggattcagtggatggagaactagaagct
ctgatggagaatggtgagggtctctctgataaaaaccaggtgctcagcttatcccggctg
atggttagaatcgaaactttggagcagaaacttacctgtctcaagctcatacagaataca
cactcacagtcttgcctgaagtcctttctggaacgtcatgggctgtctttgttgtggatc
tggatggcagagctaggtgatggtcgggaaagtaaccagaagcttcaggaagagattata
aagactttggaacacttacccattcctactaaaaatatgttggaggaaagcaaagtactt
ccaattattcagcggtggtctcagaccaagactgctgttcctcagttgagtgaaggagac
gggtattctagtgagaatacatcgcgtgctcaaacaccactcaacacacctgatccttct
accaaactgaccacagaagctgacacagacacccccaagaagctcatgtttcgcagactt
aaaattataagtgaaaatagcatggacagtgcaatctcggatgctaccagtgaattggaa
ggcaaggatggcaaagaggaccttgatcagttagaaaacgttcctgtagaagaagaggaa
gagttacaatcacaacagctgcttacacaacagctgcctgagtctaaagttgatagtgaa
atcgccatggaggccagtaagctacccatgtctgaaacagaagctgacactgaaatagag
cctaaagagaacaatggcacgaaactagaagagcctattgctgaggaaacaccatcccaa
gatgaagaggagggtgtatctgatgtggagagtgagaggagccaggaacagccagataaa
acagtagatataagtgatttggccaccaagctcctggacagttggaaagacctaaaggag
gtatatcggattccaaagaaaagtcaaactgaaaaggagaacacaataactgaacgagga
agggatgctgttggcttcagagatcaaacagctgccccaaagactcctaacaggtcaaga
gagagagacccagacaagcaaactcaaaataaagagaaaagaaaacgaaggggctccctc
tcaccaccttcttctgcctatgagcggggaacaaaaaggccagatgacagatatgataca
ccaacttctaaaaagaaagtacgaattaaagaccgcaataaactttctacagaggagcgt
cggaagttgtttgagcaagaggtggctcagcgggaggctcagaagcaacagcagcagatg
cagaacctgggaatgacgtctccactcccctatgactctcttggctacaatgcccctcat
cacccctttgctggctatccaccaggttatcccatgcaggcctatgtggatcctagcaac
cctaatgctggaaaggtgctcctccccacacccagcatggaccctgtatgttctcctgct
ccttatgatcattctcagcccttggtgggacattctacagaacctcttgctgcccctcca
cccgtgccagtggtgccacatgtggcaacccctgtggaagtttccagttcacagtatgtg
gcccaaagtgatggtgtggtacaccaagactccagtgttgctgtcttgccagtgccagcc
ccaggcccagtccagggacagaattatggtgtttgggactcaaaccaacagtctgtcagt
gtacagcagcagtactctcctgcacagtctcaagcaaccatatattatcaaggacagact
tgtccaactgtctatggtgtgacatcaccctattcacagacaactccaccaattgtacag
agttatgcccaaccaagtcttcagtacatccagggacaacagattttcacagctcaccca
cagggagtggtggtacagccagctgcagccgtaactacaatagttgcaccagggcagcct
cagcccttacagccagctgaaatggttgtgacaaataatctcttggatctgccacccccc
tctcctcccaaaccaaaaactattgtcttacctcccaactggaagacagcccgagatcca
gaagggaagatttattactaccatgtgatcacaaggcagactcagtgggatcctcctact
tgggaaagcccaggagatgatgccagccttgagcatgaagctgagatggacctgggaacc
ccaacatatgatgaaaaccccatgaagacgtcaaaaaagcctaagacagcagaagcagac
acctccagtgagctggctaagaaaagcaaagaagtattcagaaaagagatgtcccagttc
atcgtccagtgcctgaacccttaccggaaacctgactgcaaagtgggaagaattaccaca
actgaagacttcaaacacctagctcgcaagctgactcatggcgttatgaataaggagctg
aagtactgtaagaatcctgaggacctggagtgcaatgagaatgtgaaacacaaaaccaag
gagtacattaagaagtacatgcagaagtttggggctgtttacaaacccaaagaggacact
gaattagagtga

DBGET integrated database retrieval system