KEGG   Equus caballus (horse): 100065270Help
Entry
100065270         CDS       T01058                                 

Gene name
MGAM2
Definition
(RefSeq) putative maltase-glucoamylase-like protein FLJ16351
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
ecb  Equus caballus (horse)
Pathway
ecb00052  Galactose metabolism
ecb00500  Starch and sucrose metabolism
ecb01100  Metabolic pathways
ecb04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    100065270 (MGAM2)
   00500 Starch and sucrose metabolism
    100065270 (MGAM2)
 09150 Organismal Systems
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100065270 (MGAM2)
Enzymes [BR:ecb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     100065270 (MGAM2)
    3.2.1.20  alpha-glucosidase
     100065270 (MGAM2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2 Trefoil DUF5110
Motif
Other DBs
NCBI-GeneID: 100065270
NCBI-ProteinID: XP_023494572
LinkDB All DBs
Position
4
AA seq 2891 aa AA seqDB search
MARKLTVLEVLLIVFIIIILALDILLLLLVLENPSDRPVCPEIPESERIDCAPGQVVTEV
REMGSLLLPAGFYLKEMSGKKVVVEWIMGLKGLLESCYWQEYQLFERCLAVTYEFIIKAV
CRWQHKCCWKPGSDADVPTCFFPRNWGYNVSNDYKNTSAGFTAQLKRLSSPSLFGYDIVD
TLFTAEYQTANRFHFKITDFNNMRYEVPHENIQLFNETVDTSNLSYHIEVTHIPFSIKIM
RTSNKRVLLDTSIGPLLFAQQYLQLSFRLPSANVYGLGEHVHQQYRHNMTWKTWPIFTRD
ATPTEGMNNLYGAHTFFLCLEDTSGSSFGVFLLNSNAMEVTLQPAPAITYRTTGGILDFY
VFLGNTPEQVVQEYLELVGRPFLPSYWSLGFQLSRRNYGGINGLKEVVARNRAAGIPYDV
QYSDIDYMDGKKDFTIDEEAFPGLSNFIKDLHSNGMKYVIAVNPGISNNSDYLPYVNGTK
KRVWILDDNGFVTGQGYPGWTVFPDYSNPICTEWWTEEFSEFHKTLEFDGVWIEMDEVSS
FLQGSDHECESNNLNFPPFTPRVLDHFLFARTLCMDTVFHSGLHYDVHSLYGYSMARATD
SAMENVFPNKRNFILSRSTFAGSGKFVAHWLGDNAATWDDLRWSIPSILEFNLFGIPLVG
ANICGYREDVSEELCRRWMQLGAFYPLSRNHNGPEFRDQDPAAFGENSQLLNSSRHYLNI
RYTLLPYLYSLFYRAHTLGETVARPLVHEFYQDPATWEVHEQFLWGPGLLITPVLYEGVT
QVKAYIPDAIWYNYETGVAIQWRKQLVEMLLSDEKIGLHLRGGYIFPTQQPNTTTENSRK
NSLGLIIALDYKREAKGELYWDDGVSKDAVTEKNYILYDFSVTSNHLQAKIINDNYTDPN
NLTFTNIAILGMDKQPTNFTVLFNNAATPIPNVVYSASTKVVSITDLEGLVLGREFSIGW
NLPVSDLEKFNCYPEDPSASEESCRQRGCLWEHTTTPGVPTCYYDTIPSYAASNIQYLPT
GITTDLALLTAPESVGAAAPPPPSSRGMPPPPAAAAATADDLSAKIDFLQLSVIYHTENM
LQFKIYDPRNKRYEVPVPLNTPPSPVGSPENRLYDVRIQNNPFGIQIRRKSSNTVIWDSQ
LPGFTFNDMFLSISTRLPSEYIYGFGETEHTAFKRNMSWHMWGMFARDEPPAYKKNSYSV
HPYYMALEEDGSAHGVLLLNSNAMDVTFQPTPALTYRTTGGILDFYMFLGPTPELVTQQY
TELVGRPAMIPYWALGFQLSRYGYQNDTEISNLYDAMMAAQIPYDVQHVDIDYMDRKLDF
TLSSSFQNLGLLIEQMKKDGMRFILILDPAISGNETQYLTFTRGQENNVFIKWPDNSDIV
WGKVWPDLPNVIVDGSLDQETQVELYRAYVAFPDFLRNSTATWWKKEIEELYTNPREPEK
SLKFDGLWIDMNEPSNFVDGSVWGCRDETLNNPPYVPYLESRNKGLSSKTLCMESQQVLP
DGSLVRHYDVHSLYGWSQTRPTYEAVQEVTGQRGVIITRSTFPSSGRWGGHWLGDNMAAW
DQLKKSIIGMMEFSLFGISYTGADICGFFGDAEYEMCVRWMQLGAFYPFSRNHNTFGTRR
QDPVAWNSTFEMISRNVLQTRYTLLPYLYTLMHKAHVEGSTVVRPLLHEFTVDNKTWEID
DQFMLGPAILISPVLESNTFEIHAYFPSARWYDYSTESGNTSTGEWKTLQAPLDHINLHI
RGGYILPWQESAMNTYSSRQKFMGLIVALDDNGKAEGEMFWDDGQSIDTYENGNYFLAKF
TAAQNILEIQTIHNKYLSDLNPLKVGYIRIWGINSMFVTQVTFTYDNQQFMETNFKSDPY
TQTLTIQLTDKDISLEKLTEITWMYGDPIVFTTPVTSTFPMSSLHPSTSSTKATTSETII
TSSASTSTPAARTTTTLPITTPPFPTSTMEVTTSATVPITTVPSSTNSPTARTTATLPIT
TTPFPTSTMEVTTGTTVPITTMPSSTNTPTATLPITTPPFPTSAIEVTTSATVPITTMPS
PTNTPTARTTATLPITTTPFPTSTMEVTTSATVPITTVPSSTNSPTARTTATLPITTTPF
PTSTMEVTTGTTVPITTMPSSTNTPTATLPITTPPFPTSAIEVTTSATVPITTMPSSTNT
PTTRTTATLPITTPPFPTSAIEVTTSATVPITTIPSPTNTPTTRTTATLPITTPPFPTSA
IEVTTGTTVPITTVPSPTNTPTTRTTATLPITTPPFPTRTMEVTTSTTVPITTMPSSTNI
PTARTTTPLPITATPFPTSAIEVTTGTTVPITTMPSPTNTPTVSGTSNTISVTTTSFQTP
PTTLIHTLISTPNSTPPSLSTFPTSKTFTTDLITDFTTPTNADTTHLNTMDTQGTMMMDA
IVATTSTTNNTRSPDTSKDKFTAHTQPATTDFISIFPPEEITAASLSTINTAMLTSTNLG
SGTSPVVTSSINSLTTDSTTVSTLKSADTTIAIATVTDTLVSATQDLIHFPPSTEDVKTA
TTDITQLTTPHSSPTTTQTLSHTTLISTNFSNPASVNSTNTSTTSITMDSVTRNILDSTI
SRNTNTNTGFTTVTMITNATPVETTTQVTSALPPTGTHGATTTENESLMGLTRIITTTNP
PHIPTNALNTTSIGTGNSTIPSTTNVNTTNKITGVTNIISTPTRDSPTTVDGSMTTIPIV
SNFSTTTDPKIAITQDFATSPRTNTTDIESTTKATGNAIIAYTTTITTHISSTKTTNSMN
TSDTVLTNTSIPSTTAVSSTNTINSTGHEVNITDADNVSSVSGNTTHISIPNITTASDGL
MTAVLDTAIHHLVITNSTASNLSIIATNATTDVTNITIHALNTTTPDRKTMDASATASTY
IANVVNATIVP
NT seq 8676 nt NT seq  +upstreamnt  +downstreamnt
atggcgaggaagctcactgtattggaagtccttctgattgtcttcatcataatcatactt
gccttagatatcctcctgctgcttcttgtgttggagaatccttcagatcgtccagtgtgc
ccagagatccctgaatcagaaaggatagactgtgcgcctggccaggtggtgacagaggtc
agagaaatgggctccctgctgttgcctgctgggttttatttaaaagaaatgagtgggaag
aaggtggtggtggagtggattatgggcctcaagggccttctggaatcatgttactggcaa
gaatatcaactatttgaacgctgcttagctgtgacttacgaatttatcataaaggctgtc
tgcagatggcaacataaatgctgctggaagcctgggtcagatgctgatgtccctacatgc
ttcttccccaggaactggggctataatgtcagcaatgactataaaaatacaagcgcaggg
tttactgcccagttgaaaaggttgtcatccccatctctgtttggatatgatatcgtcgac
accctcttcacagctgaatatcagacagccaatcgttttcatttcaagatcactgatttc
aataacatgcgctatgaagtcccccatgaaaatattcagctgtttaatgagactgttgat
acctccaatttgagctatcacatagaggtcactcatatacccttcagcatcaaaataatg
aggacgagcaataaaagagtcttgttggacacgagcattgggcccctcctgtttgcccag
cagtacctgcagctgtctttccgactgcccagcgccaatgtgtatgggctgggggaacat
gtgcaccagcagtaccgtcacaacatgacctggaagacctggcccatcttcacccgggat
gccacccccactgagggcatgaataatctgtatggagctcatacattcttcttgtgcctt
gaagacaccagcggctcctcttttggggtttttctgttgaacagcaatgctatggaggtc
acccttcagcccgcccctgcaatcacttaccgcaccactgggggcattcttgacttttat
gtgttcctgggaaacactccagaacaagtggtgcaggaatacctggagcttgttggacga
ccattcttgccttcatactggagtcttggattccagcttagtcgcagaaattatggtggc
atcaacggattgaaagaggttgtagctcgaaatcgtgcagctgggatcccatatgatgtc
cagtattctgacatagactacatggatggaaagaaggatttcactattgatgaagaggcg
ttccctggtctctcaaattttatcaaagacttacatagcaatggaatgaaatatgtaatt
gctgtgaatcctggcatctcaaataactctgactacctgccctatgtgaatgggacaaaa
aagagagtatggatcttggatgacaatggctttgtcactgggcagggatatcccggatgg
acagtctttcccgattatagtaatccaatttgtactgagtggtggacagaggagttcagt
gaatttcataaaactctggagtttgatggagtctggattgaaatggatgaagtatctagt
tttctccaaggttctgatcatgagtgtgaatcaaacaacttgaactttcctcctttcact
cctcgagtcctggaccacttcctttttgcaagaaccctctgcatggacacggtgtttcac
tcgggccttcactatgatgtccacagcttgtatggctactccatggcaagagccacagac
tcggccatggagaatgtcttccccaataaaaggaacttcattttatcccgttctactttt
gctggatctggcaaatttgttgctcattggttgggggacaatgcagccacatgggatgat
ctccgatggtccatccccagtatccttgagttcaacctatttggcatccccctggtaggt
gccaacatctgtggttatagagaagatgtctcagaagaactctgcagaaggtggatgcag
cttggagcattttatccactatcaaggaatcataatgggcctgagttcagggaccaggat
cctgcagcctttggtgaaaactctcagctgttgaattcctccagacactatctgaacatc
cggtacaccctgctgccttatctctacagcctcttctaccgcgctcataccctgggggag
actgtagcaaggccccttgttcatgagttctaccaggacccagctacatgggaggtgcac
gagcagttcttatgggggcctggactcctcatcacgcctgttctatatgaaggtgtgacc
caagtgaaagcatacatacctgatgccatctggtataactatgagacgggagtagccatc
caatggaggaaacaattggtggagatgctactgtcagatgaaaagataggacttcacctt
cgagggggctacatatttcccacccagcagccaaacacaaccacagagaacagtcggaag
aattcccttggactcattattgctttggactataagagagaagcaaagggggaactctac
tgggatgatggtgtatctaaagatgctgtcactgaaaagaattatattttgtatgatttt
tccgtcacctctaaccatctacaggcaaagattataaatgataattatacggatcctaac
aacctcacgtttacaaatatcgcaatcttgggaatggacaagcaacctactaattttact
gtcttatttaataatgctgccacccccattccaaatgttgtctacagtgcttcaacaaag
gtggtgagcatcactgatcttgagggactggtactgggacgagaattctccatcgggtgg
aatcttccagtcagtgacctggagaagttcaactgttaccctgaggaccccagtgcctcc
gaggagagttgtaggcagcgggggtgcctttgggagcacacaactactcctggtgtgccc
acctgttactacgacaccatccctagttatgcagccagtaacattcagtacctgcccacg
ggcatcaccacagaccttgccctcttgacagctcccgagtcagtgggagcagcggcacca
ccaccaccatcatcacgaggtatgccacccccacctgcagcagcagcagccaccgctgat
gatctctctgcaaagattgacttcctccaattgagcgtcatctaccacacagaaaacatg
ctgcagttcaagatctatgaccccaggaataaaaggtatgaggtcccagtgcctctgaac
acccctccctctccagttggctcccctgaaaaccgtctgtatgatgtcaggattcagaac
aatcctttcgggatccagattcgacgaaaaagctccaatactgtgatctgggattctcag
ctccccggcttcaccttcaatgatatgttcctgtccatttctactcgcctcccttctgag
tacatctatggctttggggaaactgagcacacagctttcaaaagaaacatgagctggcac
atgtggggaatgtttgctcgagatgagccaccagcgtacaagaagaattcctatagtgtc
cacccctactatatggcactggaggaggatggcagtgcccatggagtgctcctgctaaac
agcaatgccatggatgtgacattccagcccactcctgccctgacgtaccgcaccacagga
gggattttggacttttatatgtttttgggaccaactccggagcttgtaactcagcaatac
actgagttggtcggtcggccggcaatgattccttactgggccttgggattccagctgagt
cgctatggataccagaatgatactgaaatctccaatttgtatgatgcaatgatggcagcc
cagattccctatgatgtccagcatgtagacatcgattacatggaccggaagctggacttc
actctcagctccagctttcaaaaccttggtctcctgattgagcaaatgaagaaagatggc
atgagatttattctcattctggacccagccatttctggcaatgagacccagtatctcaca
ttcaccagagggcaggaaaacaacgtattcatcaaatggcctgacaacagtgatattgtc
tggggaaaggtttggccagatctgcccaatgtgattgtggatggatcccttgaccaggaa
actcaggttgagctgtacagagcctacgttgcttttcctgatttcttgcgtaatagcaca
gccacatggtggaagaaggaaatagaagagctctatacaaaccctcgagagccagaaaag
agcttgaagtttgatggattgtggattgatatgaatgaaccatcgaactttgtggatgga
tctgtctggggctgcagagatgaaactcttaataatccaccctatgtgccgtatctggag
tccaggaacaagggtctgagcagcaaaaccctgtgcatggagagtcagcaggtcctgcca
gatggctccctggtgcggcactacgatgtgcacagcctgtacgggtggtcccagaccaga
cccacatacgaagctgtgcaggaggtgacaggacagcgaggggtcatcatcacccgctct
actttcccctcttctggccgctggggaggacactggctgggagacaacatggctgcatgg
gaccagctgaagaaatctatcattggcatgatggagttcagtctctttggaatatcttat
acgggagcagatatttgtgggttctttggagatgctgaatatgagatgtgtgttcgttgg
atgcaactgggggcattttatccattttccaggaaccacaacacattcgggacaaggcga
caagatcctgtggcctggaattcaacctttgagatgatctcaagaaacgtcctccagacc
agatacaccctgctaccttacctctatactctgatgcataaagctcacgttgagggcagc
actgttgtccgaccccttctccatgagtttacagttgacaacaaaacgtgggaaatagac
gatcagttcatgttgggacccgccatcttaatcagccccgtgctagaaagtaacactttt
gagatccatgcttattttcccagtgctcgttggtatgactatagcacggaatctggcaat
acatccacaggtgagtggaaaaccctgcaggctccccttgatcacatcaaccttcacatc
agaggaggctacatcctgccttggcaagagtctgcaatgaacacttactccagtcgacaa
aaatttatgggattgattgttgctttggatgacaatgggaaagccgaaggtgagatgttc
tgggatgatggacaaagcattgatacctatgaaaatggaaactatttcttggcaaagttt
acagcagctcagaacatattggaaattcagaccatacacaataagtatttgagtgacttg
aatccactgaaagttggatatattcgaatctgggggataaactctatgtttgtgacacaa
gtgaccttcacctatgacaaccagcaattcatggagacaaatttcaagagtgacccttac
actcagacactaactattcaattgactgacaaggatatcagcctggaaaagttaactgaa
attacttggatgtatggtgatcctatagtttttactacacccgtgacaagtaccttccca
atgagttctctacatccttctacatctagtactaaggctaccacttctgagactattatc
actagttctgctagtacaagtactcctgctgctaggactactactactcttcctatcaca
acccctcctttcccaacaagtactatggaagttacaactagtgctactgttcctattacc
actgtgccttcctcaacaaattctcctactgctaggactactgctactcttcctatcaca
accactcctttcccaacaagtactatggaagttacaactggtaccactgttcctattacc
actatgccttcctcaacaaatactcctactgctactcttcctatcacaacccctcctttc
ccaacaagtgctattgaagttacaactagtgctactgttcctattaccactatgccttcc
ccaacaaatactcctactgctaggactactgctactcttcctatcacaaccactcctttc
ccaacaagtactatggaagttacaactagtgctactgttcctattaccactgtgccttcc
tcaacaaattctcctactgctaggactactgctactcttcctatcacaaccactcctttc
ccaacaagtactatggaagttacaactggtaccactgttcctattaccactatgccttcc
tcaacaaatactcctactgctactcttcctatcacaacccctcctttcccaacaagtgcc
attgaagttacaactagtgctactgttcctattaccactatgccttcctcaacaaatact
cctactactaggactactgctactcttcctatcacaacccctcctttcccaacaagtgcc
attgaagttacaactagtgctactgttcctattaccactatcccttccccaacaaatact
cctactactaggactactgctactcttcctatcacaacccctcctttcccaacaagtgct
attgaagtgacaactggtaccactgttcctattaccactgtgccttccccaacaaatact
cctactactaggactactgctactcttcctatcacaacccctcctttcccaacaagaact
atggaagttacaactagtactactgttcctattaccactatgccttcatcaacaaatatt
cctactgctaggactactactcctcttcctatcacagccactcctttcccaacaagtgcc
attgaagttacaactggtaccactgttcctattactactatgccttccccaacaaatact
cctactgttagtggtactagtaatactatttctgtcacaactacttctttccagactcct
cccaccactctaattcatactcttatttctactcctaactctactcctcctagcttgagc
acatttccaaccagtaagacatttactactgatttaatcactgattttacaacacctact
aacgcagacaccactcatctcaacaccatggatacacaaggtaccatgatgatggatgct
atagttgctactaccagcaccacaaataataccaggagtccagatacctccaaagataaa
ttcactgcacatacccaacctgctacaactgattttataagcattttccccccagaagaa
ataactgctgcctcccttagcactattaatactgcaatgctaacttctacaaatctgggc
agtggaacctctcccgtcgtaacaagttcaataaatagcctcactacagacagtacaaca
gtaagtacacttaaatctgcagatactaccattgctatagcaactgttacagacacatta
gtctctgctacccaggaccttattcactttcccccttccactgaagatgttaaaactgcc
accacagacatcacacagctcactactccccattcttctcctactacaacacaaactttg
agccacacaacgttaatttccacaaatttttctaatccagcttctgtcaattctactaac
acaagtactacatccataactatggattcagttactagaaatattttagatagtaccatt
tcaagaaacacaaacacaaatacaggcttcaccacagttactatgattacaaatgctact
cctgtagaaactaccactcaggtcacttcagctcttcctcctacaggcacccatggtgcc
accaccacagaaaatgaatcattaatgggacttaccagaatcattaccacgactaatcct
ccacatatccctactaatgctttaaataccacatccattggcactggaaatagcactata
ccaagcaccaccaatgtaaatactaccaataaaataactggtgttaccaatattataagc
actcccactagagatagcccaactactgttgatggcagcatgacaactattcctattgtg
agtaatttttctactactacagaccccaaaattgctattactcaagactttgccacttcc
ccacgtaccaacactacagatattgaatctactactaaagctacaggaaatgccattata
gcatacaccaccaccatcactacacatatttccagcacaaaaactacaaattcaatgaat
acttctgacacagtccttacaaacacttccattccaagtaccactgccgtttcctccacc
aacactataaacagtacagggcatgaagtaaatattactgatgcagataatgtcagcagt
gtttcaggtaacactacacacatttctattccaaatatcacaacagcctctgacgggttg
atgactgctgttttagatacagcaatccaccatctggtaataacaaattctacagctagt
aatttatctattattgcaactaatgccaccacagatgttacaaatattaccatacatgct
ttaaatactaccactcctgataggaaaacaatggatgcctctgctactgcatctacttat
attgcaaatgttgtaaatgctactatagttccatga

DBGET integrated database retrieval system