KEGG   Equus caballus (horse): 100065534
Entry
100065534         CDS       T01058                                 

Gene name
POLK
Definition
(RefSeq) DNA polymerase kappa
  KO
K03511  DNA polymerase kappa [EC:2.7.7.7]
Organism
ecb  Equus caballus (horse)
Pathway
ecb03460  Fanconi anemia pathway
ecb05169  Epstein-Barr virus infection
ecb05200  Pathways in cancer
ecb05202  Transcriptional misregulation in cancer
ecb05210  Colorectal cancer
ecb05212  Pancreatic cancer
ecb05213  Endometrial cancer
ecb05214  Glioma
ecb05216  Thyroid cancer
ecb05217  Basal cell carcinoma
ecb05218  Melanoma
ecb05220  Chronic myeloid leukemia
ecb05222  Small cell lung cancer
ecb05223  Non-small cell lung cancer
ecb05224  Breast cancer
ecb05225  Hepatocellular carcinoma
ecb05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    100065534 (POLK)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100065534 (POLK)
   05202 Transcriptional misregulation in cancer
    100065534 (POLK)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100065534 (POLK)
   05212 Pancreatic cancer
    100065534 (POLK)
   05225 Hepatocellular carcinoma
    100065534 (POLK)
   05226 Gastric cancer
    100065534 (POLK)
   05214 Glioma
    100065534 (POLK)
   05216 Thyroid cancer
    100065534 (POLK)
   05220 Chronic myeloid leukemia
    100065534 (POLK)
   05217 Basal cell carcinoma
    100065534 (POLK)
   05218 Melanoma
    100065534 (POLK)
   05213 Endometrial cancer
    100065534 (POLK)
   05224 Breast cancer
    100065534 (POLK)
   05222 Small cell lung cancer
    100065534 (POLK)
   05223 Non-small cell lung cancer
    100065534 (POLK)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    100065534 (POLK)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ecb03400]
    100065534 (POLK)
Enzymes [BR:ecb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     100065534 (POLK)
DNA repair and recombination proteins [BR:ecb03400]
 Eukaryotic type
  TLS (translesion DNA synthesis) factors
   Y-family DNA polymerases
    100065534 (POLK)
SSDB
Motif
Pfam: IMS IMS_C IMS_HHH
Other DBs
NCBI-GeneID: 100065534
NCBI-ProteinID: XP_001504725
Ensembl: ENSECAG00000014876
VGNC: 21663
LinkDB
Position
14
AA seq 860 aa
MDSTKEKNENYKDDLLLRMGLNDNKAGMEGLDKEKINKIIMEATKGSRFYGNELKKEKQV
NRRIENMMQQKAQITSQQLRKAQLQVDKFAMELEQSRDLNNTIVHIDMDAFYAAVEMRDN
PELKDKPIAVGSMSMLSTSNYHARRFGVRAAMPGFIAKRLCPQLLIVPPNFDKYRAVSRE
VKEILADYDPNFLAMSLDEAYLNITKHLQERQNWPEDKRKYFIKTGSSLDNDKPGKEVKL
GECERSISPLLFEDTPPDLQPPGNPSQVNIEEQNNPQEFQNSVVFGTSAEEVVKEIRFRI
EQKTTLTASAGIAPNTMLAKVCSDKNKPNGQYQILPDRQAVMDFIKDLPIRKVSGIGKVT
EKMLKALGIITCTELYQQRALLSLLFSETSWHQFLHVSMGLGSTHLARDGERKSRSVERT
FSEMSKAEEQYSLCQELCGELAQDLQKEGLKGRTVTIKLKNVNFEVKTRASTVSSVISTA
EEIFAIAKELLRTEIDADFPHPLRLRLMGVRVSGFPNEEEKKHQQRSIIGFLQAGNQTPS
ATGCRLEKTEKDQFLKPLEMSHKKSFFDKKRSERKWSHQDTFKCETVDQKSLQTSQSFQV
LKQKMSENLETSENSDNCQIFTCPVCFREQGSVSLEAFNKHVDACLDAPSISENSEMSSC
SHASSTEVNKKENVHPSFSLCEKQDYKARQKNIETTSGDCVELVETIDNPAKAEGVDALS
NKHSKEECSSLPSKPFNVEHCHQKSCTVSLEDEDVESLRRQEPVQALVCPVCNLEQKTSD
LTLFNVHVDICLNKGIIQELRNDEVNPVNQPKESTKSTGNSGRVQKTITKTKRPGLVTKH
SASKKVKPSNPRHTLDVFFK
NT seq 2583 nt   +upstreamnt  +downstreamnt
atggatagcacaaaggagaagaatgaaaattacaaagatgacctcctgcttaggatgggg
cttaatgataataaagctggaatggaaggattagacaaagaaaaaattaacaaaattata
atggaagccacaaaggggtccagattttatggaaatgagctcaagaaagaaaagcaagtc
aaccgacggattgagaatatgatgcaacaaaaagctcaaatcaccagccagcagctaagg
aaagcacagttacaggttgacaaatttgcaatggaattagaacagagccgggatctgaac
aataccatagtgcacattgacatggatgctttctatgcagctgtagaaatgagggacaat
ccagaattgaaggataaacccattgctgtaggatcaatgagtatgttgtctacttcaaat
taccacgcgaggaggtttggtgttcgtgcagccatgccaggatttattgctaaaagactc
tgcccacaacttctcattgtgccgccaaactttgacaagtaccgagctgtgagtcgagag
gtcaaggaaatacttgctgattatgatcccaattttctggccatgagtcttgatgaagcc
tacttgaatataacaaagcacttacaagaaagacagaattggcctgaggacaaaaggaag
tatttcatcaaaacagggagctctctagacaacgataaaccaggaaaggaagttaaactg
ggtgagtgtgaacgatccatctctccactactttttgaagatactcctcctgatttgcag
cccccaggaaatccttcccaagtgaacattgaagaacaaaataatcctcaagaattccag
aactcagttgtttttggaacatcagccgaggaagtggtaaaggaaattcgtttcagaatc
gagcagaaaacaacactgacagccagtgcaggcattgctccaaatacaatgttagcaaaa
gtatgcagtgataagaataaaccaaatggacagtaccaaattctgcccgacagacaggct
gtgatggacttcatcaaggacctacccatcagaaaggtttctggaataggcaaagttaca
gagaaaatgttaaaggcccttggaattattacatgtacagaactctaccaacagagggca
ttactttctctccttttctctgaaacatcttggcatcagttccttcacgtttccatgggt
ctcggttcaacacacctggcaagagatggagagaggaaaagcaggagcgttgaaaggaca
ttcagtgagatgagtaaagcagaagaacagtacagtttgtgccaagaactttgcggtgaa
ctcgctcaagatctgcagaaagaaggacttaagggtaggactgtcaccattaagctgaag
aatgtgaattttgaagtgaaaactcgtgcatctacagtttcatcagttatttctactgca
gaagaaatatttgctattgctaaagaactactcagaacagaaattgatgctgattttcca
catcccttgagattaagacttatgggtgtgcgagtgtctggttttcccaatgaagaagag
aagaaacaccaacagaggagcattattggcttcttacaggctggaaaccaaaccccatca
gccactgggtgtagactagagaaaactgagaaagatcagtttctaaaacctctagaaatg
tctcataagaagagtttctttgataaaaaacgatcagaaaggaaatggagtcaccaagac
acatttaaatgtgaaactgtggatcaaaaaagtttacagacatcacaatcattccaagtt
ttaaagcagaagatgagtgagaatttagaaacatcagagaattcagataactgtcagata
tttacttgtcctgtttgctttagggagcagggaagcgtcagtctggaagcctttaataaa
catgtagatgcgtgtcttgatgcaccttcaatcagtgagaactctgaaatgtcctcatgt
tcacatgcgtcctctacagaagttaacaagaaagagaatgtacatccttctttttcactc
tgtgagaagcaggattacaaagcccgtcagaagaatatagaaaccacttcaggagattgt
gtagagttggtagagaccatagataacccagctaaagcagaaggtgtagatgccttaagt
aataaacacagcaaagaggaatgttccagtcttccaagcaaaccatttaatgttgaacac
tgtcatcagaagtcttgtactgtttcattggaagatgaagatgttgagtccttaagaagg
caagagcccgtccaagctttagtttgtcctgtttgtaacctggaacaaaagacttcagat
cttaccctgttcaatgtgcatgtggatatttgtttaaataaaggcattatccaggaactg
agaaatgatgaagttaatccagttaaccaacccaaagaaagtaccaaaagtaccggtaac
tcaggaagagtacagaaaactataacaaaaacaaaaaggccagggttggtgacaaagcac
tcagcatcaaagaaagtaaaacccagcaatccaagacacacccttgatgtattttttaaa
tga

DBGET integrated database retrieval system