KEGG   Equus caballus (horse): 100065760
Entry
100065760         CDS       T01058                                 

Gene name
BRAF
Definition
(RefSeq) serine/threonine-protein kinase B-raf isoform X2
  KO
K04365  B-Raf proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
ecb  Equus caballus (horse)
Pathway
ecb01521  EGFR tyrosine kinase inhibitor resistance
ecb01522  Endocrine resistance
ecb04010  MAPK signaling pathway
ecb04012  ErbB signaling pathway
ecb04015  Rap1 signaling pathway
ecb04024  cAMP signaling pathway
ecb04062  Chemokine signaling pathway
ecb04068  FoxO signaling pathway
ecb04150  mTOR signaling pathway
ecb04270  Vascular smooth muscle contraction
ecb04510  Focal adhesion
ecb04650  Natural killer cell mediated cytotoxicity
ecb04720  Long-term potentiation
ecb04722  Neurotrophin signaling pathway
ecb04726  Serotonergic synapse
ecb04730  Long-term depression
ecb04810  Regulation of actin cytoskeleton
ecb04910  Insulin signaling pathway
ecb04914  Progesterone-mediated oocyte maturation
ecb04928  Parathyroid hormone synthesis, secretion and action
ecb04934  Cushing syndrome
ecb05010  Alzheimer disease
ecb05022  Pathways of neurodegeneration - multiple diseases
ecb05034  Alcoholism
ecb05160  Hepatitis C
ecb05161  Hepatitis B
ecb05200  Pathways in cancer
ecb05205  Proteoglycans in cancer
ecb05210  Colorectal cancer
ecb05211  Renal cell carcinoma
ecb05212  Pancreatic cancer
ecb05213  Endometrial cancer
ecb05214  Glioma
ecb05215  Prostate cancer
ecb05216  Thyroid cancer
ecb05218  Melanoma
ecb05219  Bladder cancer
ecb05220  Chronic myeloid leukemia
ecb05221  Acute myeloid leukemia
ecb05223  Non-small cell lung cancer
ecb05224  Breast cancer
ecb05225  Hepatocellular carcinoma
ecb05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100065760 (BRAF)
   04012 ErbB signaling pathway
    100065760 (BRAF)
   04015 Rap1 signaling pathway
    100065760 (BRAF)
   04068 FoxO signaling pathway
    100065760 (BRAF)
   04024 cAMP signaling pathway
    100065760 (BRAF)
   04150 mTOR signaling pathway
    100065760 (BRAF)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100065760 (BRAF)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100065760 (BRAF)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100065760 (BRAF)
   04062 Chemokine signaling pathway
    100065760 (BRAF)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100065760 (BRAF)
   04914 Progesterone-mediated oocyte maturation
    100065760 (BRAF)
   04928 Parathyroid hormone synthesis, secretion and action
    100065760 (BRAF)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100065760 (BRAF)
  09156 Nervous system
   04726 Serotonergic synapse
    100065760 (BRAF)
   04720 Long-term potentiation
    100065760 (BRAF)
   04730 Long-term depression
    100065760 (BRAF)
   04722 Neurotrophin signaling pathway
    100065760 (BRAF)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100065760 (BRAF)
   05205 Proteoglycans in cancer
    100065760 (BRAF)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100065760 (BRAF)
   05212 Pancreatic cancer
    100065760 (BRAF)
   05225 Hepatocellular carcinoma
    100065760 (BRAF)
   05226 Gastric cancer
    100065760 (BRAF)
   05214 Glioma
    100065760 (BRAF)
   05216 Thyroid cancer
    100065760 (BRAF)
   05221 Acute myeloid leukemia
    100065760 (BRAF)
   05220 Chronic myeloid leukemia
    100065760 (BRAF)
   05218 Melanoma
    100065760 (BRAF)
   05211 Renal cell carcinoma
    100065760 (BRAF)
   05219 Bladder cancer
    100065760 (BRAF)
   05215 Prostate cancer
    100065760 (BRAF)
   05213 Endometrial cancer
    100065760 (BRAF)
   05224 Breast cancer
    100065760 (BRAF)
   05223 Non-small cell lung cancer
    100065760 (BRAF)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100065760 (BRAF)
   05022 Pathways of neurodegeneration - multiple diseases
    100065760 (BRAF)
  09165 Substance dependence
   05034 Alcoholism
    100065760 (BRAF)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100065760 (BRAF)
  09172 Infectious disease: viral
   05161 Hepatitis B
    100065760 (BRAF)
   05160 Hepatitis C
    100065760 (BRAF)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100065760 (BRAF)
   01522 Endocrine resistance
    100065760 (BRAF)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ecb01001]
    100065760 (BRAF)
Enzymes [BR:ecb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100065760 (BRAF)
Protein kinases [BR:ecb01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   100065760 (BRAF)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase RBD C1_1 Kinase-like zf-RING-like C1_2 Pkinase_fungal APH Kdo
Other DBs
NCBI-GeneID: 100065760
NCBI-ProteinID: XP_001496314
Ensembl: ENSECAG00000002746
VGNC: 15875
LinkDB
Position
4
AA seq 764 aa
MAALSGGGGGAEQGQALFNGDMEPEAGAGAAASSAADPAIPEEVWNIKQMIKLTQEHIEA
LLDKFGGEHNPPSIYLEAYEEYTSKLDALQQREQQLLESLGNGTDFSVSSSASTDTVTSS
SSSSLSVLPSSLSVFQNPTDVSRSNPKSPQKPIVRVFLPNKQRTVVPARCGVTVRDSLKK
ALMMRGLIPECCAVYRIQDGEKKPIGWDTDISWLTGEELHVEVLENVPLTTHNFVRKTFF
TLAFCDFCRKLLFQGFRCQTCGYKFHQRCSTEVPLMCVNYDQLDLLFVSKFFEHHPVSQE
EASLAETALTSGSSPSAPPSDSIGPQILTSPSPSKSIPIPQPFRPADEDHRNQFGQRDRS
SSAPNVHINTIEPVNIDDLIRDQGFRSDGGSTTGLSATPPASLPGSLTNVKALQKSPGPQ
RERKSSSSSEDRNRMKTLGRRDSSDDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVK
MLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLHI
IETKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATVKSR
WSGSHQFEQLSGSILWMAPEVIRMQDKNPYSFQSDVYAFGIVLYELMTGQLPYSNINNRD
QIIFMVGRGYLSPDLSKVRSNCPKAMKRLMAECLKKKRDERPLFPQILASIELLARSLPK
IHRSASEPSLNRAGFQTEDFSLYACASPKTPIQAGGYGEFAAFK
NT seq 2295 nt   +upstreamnt  +downstreamnt
atggcggcgctgagcggcggcggcggcggcgcggagcagggccaggctctgttcaacggg
gacatggagccggaggccggcgccggcgccgcggcctcgtcggccgcggaccctgccatt
cccgaggaggtatggaatatcaaacaaatgattaaattgacacaggaacatatagaggcc
ctattggacaaatttggtggggagcataatccaccatcaatatatctggaggcctatgaa
gaatacaccagcaagctagatgccctccaacaaagagaacaacagttattggaatccctg
gggaatggaactgatttttctgtttctagttctgcatcaacggacaccgttacatcttct
tcctcttctagcctttcagtgctaccttcatctctttcagtttttcaaaatcccacagat
gtgtcacggagcaaccctaagtcaccacaaaaacctatcgttagagtcttcctgcccaac
aaacagaggacagtggtacctgcaaggtgtggcgttacagtccgggacagtctaaagaaa
gcactgatgatgagaggtctaatcccagagtgctgtgctgtttacagaattcaggatgga
gagaagaaaccaattggctgggacactgatatttcctggctcactggagaggaattgcat
gtagaagtgttggagaatgttccacttacaacacacaactttgtacggaaaacttttttc
accttagcattttgtgacttttgtcgaaagctgcttttccagggtttccgctgtcaaaca
tgtggttataaatttcaccagcgttgtagtacagaggttccactgatgtgtgttaattat
gaccaacttgatttgctgtttgtctccaagttctttgaacaccacccagtatcacaggag
gaggcctccttagcagagactgcccttacatctggatcatccccttctgcacccccctcc
gattccattgggccccaaattctcaccagtccatctccttcaaaatccattccaattcca
cagcctttccgaccagcagatgaagatcatcgaaatcagtttggacaacgagaccggtcc
tcatcagctccaaatgtacatataaacacaatagaacctgtcaatattgatgacttgatt
agagaccaagggtttcgtagtgatggaggatcaaccacaggtttatctgccaccccccct
gcctcattacctggctcactcactaatgtgaaggcattacagaaatctccaggacctcaa
cgggaaaggaaatcatcttcatcctcagaagacaggaatcgaatgaaaactcttggtaga
cgggattcaagtgacgattgggagattcctgatgggcagatcacagtgggacaaagaatt
ggatctgggtcatttgggacagtctacaagggaaagtggcatggtgatgtggcagtgaaa
atgttgaatgtgacagcacccacacctcagcagttacaggccttcaaaaatgaagtagga
gtactcaggaaaactcgacatgtgaatatcctactcttcatgggctattcaacaaagcca
caactggctattgttacccagtggtgtgagggctccagcttatatcaccatctccacatc
attgagaccaaatttgagatgatcaaacttatagatattgctcggcaaactgcacagggc
atggattacttacacgccaagtcaatcatccacagagacctcaagagtaataatattttt
cttcatgaagacctcacagtaaaaataggtgattttggtctagccacagtgaaatctcga
tggagtgggtcccatcagtttgaacagttgtctggatccattttgtggatggcaccagaa
gtaatcagaatgcaagataaaaacccgtatagctttcaatcagatgtatatgcctttggg
attgttctgtatgaattgatgactggacagttaccttattcaaacatcaacaacagggac
cagataatttttatggtgggaagaggatatctatctccagatctcagtaaggtacggagt
aactgtccaaaagccatgaagagattaatggcagagtgcctaaaaaagaaaagagacgag
agaccactcttcccccaaattctcgcctctattgagctgctggcccgctcattgccaaaa
attcaccgcagtgcatcagagccctccttgaatcgggctggcttccagacagaggatttt
agtctatatgcttgtgcttctccgaaaacacccatccaggcagggggatatggagaattt
gcagccttcaagtag

DBGET integrated database retrieval system