KEGG   Equus caballus (horse): 100066558
Entry
100066558         CDS       T01058                                 

Gene name
FOXO3
Definition
(RefSeq) forkhead box protein O3
  KO
K09408  forkhead box protein O3
Organism
ecb  Equus caballus (horse)
Pathway
ecb01521  EGFR tyrosine kinase inhibitor resistance
ecb04062  Chemokine signaling pathway
ecb04068  FoxO signaling pathway
ecb04137  Mitophagy - animal
ecb04151  PI3K-Akt signaling pathway
ecb04152  AMPK signaling pathway
ecb04211  Longevity regulating pathway
ecb04213  Longevity regulating pathway - multiple species
ecb04218  Cellular senescence
ecb04722  Neurotrophin signaling pathway
ecb04917  Prolactin signaling pathway
ecb05213  Endometrial cancer
ecb05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100066558 (FOXO3)
   04151 PI3K-Akt signaling pathway
    100066558 (FOXO3)
   04152 AMPK signaling pathway
    100066558 (FOXO3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    100066558 (FOXO3)
  09143 Cell growth and death
   04218 Cellular senescence
    100066558 (FOXO3)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    100066558 (FOXO3)
  09152 Endocrine system
   04917 Prolactin signaling pathway
    100066558 (FOXO3)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100066558 (FOXO3)
  09149 Aging
   04211 Longevity regulating pathway
    100066558 (FOXO3)
   04213 Longevity regulating pathway - multiple species
    100066558 (FOXO3)
 09160 Human Diseases
  09162 Cancer: specific types
   05213 Endometrial cancer
    100066558 (FOXO3)
   05223 Non-small cell lung cancer
    100066558 (FOXO3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100066558 (FOXO3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ecb03000]
    100066558 (FOXO3)
Transcription factors [BR:ecb03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix other regulators
    100066558 (FOXO3)
SSDB
Motif
Pfam: FOXO_KIX_bdg Forkhead FOXO-TAD
Other DBs
NCBI-GeneID: 100066558
NCBI-ProteinID: XP_023506650
VGNC: 51029
LinkDB
Position
10
AA seq 671 aa
MAEAPASPAPLSPLEVELDPEFEPQSRPRSCTWPLQRPELQGSPAKPSGEAAADSMIPEE
EDDEDDEDGGGRAGSAMAISGGGSGTLGSGLLLEESARLLAPGGQDLGSGPAPAAGALSG
GTQTPLQPQQSLPPPQPGTAGGSGQPRKCSSRRNAWGNLSYADLITRAIESSPDKRLTLS
QIYEWMVRCVPYFKDKGDSNSSAGWKNSIRHNLSLHSRFMRVQNEGTGKSSWWIINPDGG
KSGKAPRRRAVSMDNSNKYTKSRGRAAKKKAALQTAPESADDSPSQLSKWPGSPTSRSSD
ELDAWTDFRSRTNSNASTVSGRLSPILASTELDDVQDDDAPLSPMLYSSSASLSPSVSKP
CTVELPRLTDMAGTMNLNDGLADNLMEDLLDNITLPSSQPSPPGGLMQRSSSFPYTTKGS
GLGSPTSSFNSTVFGPSSLNSLRQSPMQTIQENKPATFSSMSHYGNQTLQDLLTSDSLSH
SDVMMTQSDPLMSQASTAVSAQNSRRNVMLRNDPMMSFAAQPNQGSLVNQNLLHHQHQTQ
GALGGSRALSNSVSNMGLSDSSSLGSAKHQQQSVSQSMQTLSDSLSGSSLYSTSANLPVM
GHEKFPSDLDLDMFNGSLECDMESIIRSELMDADGLDFNFDSLISTQNVVGLNVGNFTGA
KQASSQSWVPG
NT seq 2016 nt   +upstreamnt  +downstreamnt
atggcagaggcgccggcctccccggccccgctctctccgctcgaagtggagctggacccg
gagttcgagccccagagccggccgcgctcctgtacgtggcccctgcagaggccagagctc
caggggagcccggccaagccctcgggggaggcggccgccgactccatgatccccgaggag
gaggacgatgaagacgacgaggacggtggtggtagggccggctcggccatggcgatcagc
ggcggcgggagcggcacgctgggctccgggctgctccttgaggagtcggctcggctgctg
gctcccggagggcaggacctcgggtccgggccagcccccgcggcgggcgcgctgagcggg
gggacgcagacgccgttgcagcctcagcagtcactgccaccgccgcagccggggacggcg
gggggttccgggcagccgaggaaatgctcgtcgcggcggaacgcctgggggaacctgtcc
tacgccgacctgatcactcgcgccatcgagagctccccggacaaacggctcactctgtcc
cagatctacgagtggatggtgcgttgcgtgccctacttcaaggataagggcgacagcaac
agctctgccggctggaagaactctatccggcataacctgtcgctgcacagccggttcatg
cgggtccagaacgaggggacgggcaagagttcttggtggatcatcaaccctgatgggggc
aagagcgggaaggcaccacggcggcgggctgtctccatggacaacagcaacaagtatacc
aagagccgtggccgcgcagccaagaagaaggcagccctgcagacagcccctgagtcagca
gatgacagtccctcccagctctccaagtggcccggcagccccacgtcacgcagcagcgat
gagctggatgcatggacggacttccgctcacgcaccaattccaatgccagcactgtcagc
ggccgcctgtcacccatcctggcaagcacagagttggatgacgtccaggatgatgatgcc
ccgctctcccccatgctctatagcagctcagccagcctgtcaccctctgtaagcaagcca
tgcaccgtggagctgccacggctgaccgacatggcgggcaccatgaatctgaatgatggg
ctggctgacaacctcatggaggacctgctggataacatcacgctcccatcctcccagcca
tcgccccctggagggctcatgcagcggagctctagcttcccatacaccaccaagggctcc
ggcctgggctctcccaccagctcctttaacagcacggtgtttggaccctcgtctctgaat
tctctgcgtcagtcgcccatgcagaccatccaagagaacaagccagctaccttctcttcc
atgtcacactatggcaaccagacactccaggacctgctcacttcggactcactcagccac
agtgatgtcatgatgacccagtcggaccccttgatgtctcaggccagcaccgctgtgtcc
gcccagaactcccgccggaacgtgatgcttcgcaacgacccaatgatgtcctttgctgcc
cagcctaaccaagggagtttggtcaatcagaacttgctccaccaccagcaccaaacccag
ggcgctctcggtggcagccgtgccttgtcgaattccgtcagcaacatgggcttgagcgac
tccagcagccttgggtcagccaaacaccagcagcagtctgtcagccagtctatgcaaacc
ctctcagactctctctcaggctcctccttgtactcaactagtgcaaaccttcccgtcatg
ggccatgagaagttccccagtgacttggacctggacatgttcaatgggagcttggaatgt
gacatggagtccattatccgtagtgaactcatggatgctgatgggttggattttaacttt
gattccctcatctccacacagaacgttgttggtttgaacgtggggaacttcactggtgct
aagcaggcctcatctcagagctgggtgccaggctga

DBGET integrated database retrieval system