KEGG   Equus caballus (horse): 100066844
Entry
100066844         CDS       T01058                                 

Gene name
CDH1
Definition
(RefSeq) cadherin-1
  KO
K05689  cadherin 1, type 1, E-cadherin
Organism
ecb  Equus caballus (horse)
Pathway
ecb04015  Rap1 signaling pathway
ecb04371  Apelin signaling pathway
ecb04390  Hippo signaling pathway
ecb04514  Cell adhesion molecules
ecb04520  Adherens junction
ecb05100  Bacterial invasion of epithelial cells
ecb05200  Pathways in cancer
ecb05213  Endometrial cancer
ecb05216  Thyroid cancer
ecb05218  Melanoma
ecb05219  Bladder cancer
ecb05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100066844 (CDH1)
   04390 Hippo signaling pathway
    100066844 (CDH1)
   04371 Apelin signaling pathway
    100066844 (CDH1)
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100066844 (CDH1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    100066844 (CDH1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100066844 (CDH1)
  09162 Cancer: specific types
   05226 Gastric cancer
    100066844 (CDH1)
   05216 Thyroid cancer
    100066844 (CDH1)
   05218 Melanoma
    100066844 (CDH1)
   05219 Bladder cancer
    100066844 (CDH1)
   05213 Endometrial cancer
    100066844 (CDH1)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    100066844 (CDH1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ecb03036]
    100066844 (CDH1)
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:ecb04515]
    100066844 (CDH1)
   04090 CD molecules [BR:ecb04090]
    100066844 (CDH1)
Chromosome and associated proteins [BR:ecb03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    100066844 (CDH1)
Cell adhesion molecules [BR:ecb04515]
 Cadherins
  Major cadherins
   100066844 (CDH1)
CD molecules [BR:ecb04090]
 Proteins
  100066844 (CDH1)
SSDB
Motif
Pfam: Cadherin Cadherin_C Cadherin_pro Cadherin_2 BACON_2 Amnionless Big_9 DUF4999
Other DBs
NCBI-GeneID: 100066844
NCBI-ProteinID: XP_023492960
Ensembl: ENSECAG00000021418
VGNC: 16315
LinkDB
Position
3
AA seq 884 aa
MGPPCRSLSALLLLLQVSSRLCQEPEPCRPGFGAQSYTFTVPRRHLERGRVLGRVSFEGC
TGQPRTVYASDDTRFRVGTDGVVMVKRPLQLHNPEMSFLVHAWDSSRRKLSTKVTVKAAT
HEHHRHHHHHEAVSGTHTEVLTFPSSHHGLRRQKRDWVIPPISCPENEKGPFPKNLVQIK
SNRDKETKVFYSITGQGADTPPVGVFIIERETGWLKVTEPLDREEISKYILFSHAVSSNG
NAIEDPMEIVITVTDQNDNKPEFTQLVFEGSVMEGALPGTSVMQVTATDADDDVNTYNAA
IVYSILSQEPMLPHKQMFTINRDTGVISVLTTGLDRESFPTYTLVVQAADLQGEGLSTTA
TAVITVTDANDNPPVFNPTLYEGQVPENQADVLITRLKVTDADVPNTPAWEAVYTILNDN
EQQFVVTTDPVTNEGILKTAKGLDFEAKQQYNLFVTVKNVAPFEVTLSTSTATVTVDVMD
VNEAPIFVPPQKRVEVPEDFGVGLEITSYTAQDPDKFMEQKITYRIWRDAANWLKINPDT
GAISTQAELDRENLEHVKNSTYTALIIATDNGSPLATGTGTLLLILSDVNDNGPIPEPRN
MDFCQKDPQPHIINIIDPDLPPNTSPFTAELTHGASVNWTIEYNDPAHESLVLKPKKILE
LGDYKINLKLMDNQNKDQVTTLDVAVCDCEGAVTNCGRNRQVAEAGLQVSAILGILGGIL
ALLLLILLLLLFLRRRGVVKEPLLPPEDDTRDNVYYYDEEGGGEEDQDFDLSQLHRGLDA
RPEVIRNDVAPTLLSVPQYRPRPANPDEIGNFIDENLKAADSDPTAPPYDSLLVFDYEGS
GSEAATLSSLNSSESDQDQNYDYLNEWGNRFKKLADMYGGGEDD
NT seq 2655 nt   +upstreamnt  +downstreamnt
atgggccctccgtgccgcagcctctccgcgctcctgctgctgctgcaggtctcttcgcgg
ctctgccaggagccggagccctgccgtcccggctttggtgcccagagctacacgttcacg
gtgccccggcggcacttggagaggggccgagtcctgggcagagtgagttttgaaggatgc
actggtcagccgaggacagtctatgcttctgatgacacccgattcagagtgggcacagat
ggtgtggttatggtcaagcggcctctacagcttcataatccggagatgagttttcttgtc
catgcctgggactccagccgcaggaagctctctaccaaggttaccgtgaaggcagccacg
cacgagcaccaccgccaccaccaccaccatgaggctgtctctggaacccatacagaagtg
ctcacatttcccagctcccaccatggtcttagaagacagaagagagactgggttatccct
cctatcagctgcccagaaaatgagaaaggcccatttcctaagaatctggttcagataaaa
tctaacagggacaaagaaaccaaggttttctatagcatcactggccaaggagccgacaca
ccccctgttggtgtgtttattattgaaagagaaacaggatggttaaaggtgacagagcct
ctggatagagaagaaatttccaagtacattctcttctctcatgctgtgtcttcgaatggg
aatgcaatcgaggacccgatggagattgtgatcacggtgacagatcagaatgacaacaag
cccgagttcacccagctggtctttgaagggtctgtcatggaaggtgctcttccaggaacc
tctgtgatgcaggtcacggccacagatgcagacgatgacgtgaatacctacaatgctgcc
attgtgtactccatcctcagccaagagcctatgctgcctcacaagcaaatgttcaccatc
aacagggacacgggagtcatcagtgtgctcaccaccgggctggaccgggagagttttccc
acatataccctagtggtccaggctgctgaccttcaaggtgagggcttaagtacaactgcc
acagccgtgatcacagtcactgacgccaatgacaaccctcccgtcttcaaccccaccttg
tacgaggggcaggtgcctgagaaccaggctgatgtcctaatcaccagactcaaagtgacg
gatgccgacgtccccaacaccccggcatgggaggccgtgtacaccatattaaatgataat
gagcagcaatttgttgtcaccacagacccagtaaccaatgaaggcattttgaaaacagct
aagggcttagattttgaggccaagcagcagtataatctgtttgtgaccgtgaagaatgtg
gccccctttgaggtcactctctccacctccacagccactgtcaccgtggacgtgatggat
gtgaacgaagcccccatctttgtgcctccccaaaagagagtggaagtgcctgaagacttc
ggcgtgggcctggaaatcacatcctacactgcccaggatcccgacaagtttatggaacag
aagataacgtatcggatttggagggatgctgccaactggctgaagattaatcctgacact
ggtgccatttccactcaggctgagttggacagagagaacttggagcacgtgaagaacagc
acgtacacggccctcattatagccacggacaacggttctccacttgctactggaacggga
acccttcttctgatcctctccgatgtgaatgacaatggccctataccagaacctcgaaat
atggacttctgccagaaggatccgcagcctcatatcatcaacatcattgacccagatctt
ccccccaacacatcccccttcacagcagaactaacacatggggcaagtgtcaactggacc
atcgagtacaatgacccagcccacgaatctcttgttttgaagccaaagaaaatcctagag
ttgggtgactacaaaataaatctcaagctcatggataaccagaacaaagaccaagtgacc
accttagatgtggctgtgtgtgactgtgaaggggccgtcaccaactgtgggaggaacagg
caggttgctgaagcaggattgcaggtttctgccattctggggattcttggaggcatcctt
gctttgctactcctgattctgctacttctgctatttcttcggagaagaggggtggtcaaa
gagcccttactgcccccagaagatgacacccgggacaatgtttattactatgatgaagaa
ggaggtggagaagaagaccaggactttgacttgagccagttacacaggggcctggatgct
cggcccgaagtgattcgcaatgatgtggcgccaaccctcttgagtgtacctcaatatcgg
ccccgcccagccaatcctgatgaaattggaaacttcattgatgagaacctgaaggcagcc
gatagtgaccccactgcccccccttacgactctctgctcgtgtttgactatgaaggaagc
ggttctgaagctgctactctgagctccctgaactcctcggagtcggaccaagaccagaac
tacgactacctgaacgaatggggcaatcgcttcaagaagctggcggacatgtacggaggt
ggcgaggacgactag

DBGET integrated database retrieval system