KEGG   Equus caballus (horse): 100067469
Entry
100067469         CDS       T01058                                 

Gene name
JUN
Definition
(RefSeq) transcription factor AP-1
  KO
K04448  transcription factor AP-1
Organism
ecb  Equus caballus (horse)
Pathway
ecb01522  Endocrine resistance
ecb04010  MAPK signaling pathway
ecb04012  ErbB signaling pathway
ecb04024  cAMP signaling pathway
ecb04137  Mitophagy - animal
ecb04210  Apoptosis
ecb04310  Wnt signaling pathway
ecb04380  Osteoclast differentiation
ecb04510  Focal adhesion
ecb04530  Tight junction
ecb04620  Toll-like receptor signaling pathway
ecb04621  NOD-like receptor signaling pathway
ecb04625  C-type lectin receptor signaling pathway
ecb04657  IL-17 signaling pathway
ecb04658  Th1 and Th2 cell differentiation
ecb04659  Th17 cell differentiation
ecb04660  T cell receptor signaling pathway
ecb04662  B cell receptor signaling pathway
ecb04668  TNF signaling pathway
ecb04722  Neurotrophin signaling pathway
ecb04912  GnRH signaling pathway
ecb04915  Estrogen signaling pathway
ecb04921  Oxytocin signaling pathway
ecb04926  Relaxin signaling pathway
ecb04932  Non-alcoholic fatty liver disease
ecb04933  AGE-RAGE signaling pathway in diabetic complications
ecb05030  Cocaine addiction
ecb05031  Amphetamine addiction
ecb05132  Salmonella infection
ecb05133  Pertussis
ecb05135  Yersinia infection
ecb05140  Leishmaniasis
ecb05142  Chagas disease
ecb05161  Hepatitis B
ecb05162  Measles
ecb05166  Human T-cell leukemia virus 1 infection
ecb05167  Kaposi sarcoma-associated herpesvirus infection
ecb05169  Epstein-Barr virus infection
ecb05170  Human immunodeficiency virus 1 infection
ecb05171  Coronavirus disease - COVID-19
ecb05200  Pathways in cancer
ecb05203  Viral carcinogenesis
ecb05210  Colorectal cancer
ecb05211  Renal cell carcinoma
ecb05224  Breast cancer
ecb05231  Choline metabolism in cancer
ecb05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ecb05321  Inflammatory bowel disease
ecb05323  Rheumatoid arthritis
ecb05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100067469 (JUN)
   04012 ErbB signaling pathway
    100067469 (JUN)
   04310 Wnt signaling pathway
    100067469 (JUN)
   04668 TNF signaling pathway
    100067469 (JUN)
   04024 cAMP signaling pathway
    100067469 (JUN)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    100067469 (JUN)
  09143 Cell growth and death
   04210 Apoptosis
    100067469 (JUN)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100067469 (JUN)
   04530 Tight junction
    100067469 (JUN)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100067469 (JUN)
   04621 NOD-like receptor signaling pathway
    100067469 (JUN)
   04625 C-type lectin receptor signaling pathway
    100067469 (JUN)
   04660 T cell receptor signaling pathway
    100067469 (JUN)
   04658 Th1 and Th2 cell differentiation
    100067469 (JUN)
   04659 Th17 cell differentiation
    100067469 (JUN)
   04657 IL-17 signaling pathway
    100067469 (JUN)
   04662 B cell receptor signaling pathway
    100067469 (JUN)
  09152 Endocrine system
   04912 GnRH signaling pathway
    100067469 (JUN)
   04915 Estrogen signaling pathway
    100067469 (JUN)
   04921 Oxytocin signaling pathway
    100067469 (JUN)
   04926 Relaxin signaling pathway
    100067469 (JUN)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100067469 (JUN)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100067469 (JUN)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100067469 (JUN)
   05203 Viral carcinogenesis
    100067469 (JUN)
   05231 Choline metabolism in cancer
    100067469 (JUN)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100067469 (JUN)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100067469 (JUN)
   05211 Renal cell carcinoma
    100067469 (JUN)
   05224 Breast cancer
    100067469 (JUN)
  09163 Immune disease
   05323 Rheumatoid arthritis
    100067469 (JUN)
   05321 Inflammatory bowel disease
    100067469 (JUN)
  09165 Substance dependence
   05030 Cocaine addiction
    100067469 (JUN)
   05031 Amphetamine addiction
    100067469 (JUN)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100067469 (JUN)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100067469 (JUN)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100067469 (JUN)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100067469 (JUN)
   05135 Yersinia infection
    100067469 (JUN)
   05133 Pertussis
    100067469 (JUN)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100067469 (JUN)
   05170 Human immunodeficiency virus 1 infection
    100067469 (JUN)
   05161 Hepatitis B
    100067469 (JUN)
   05171 Coronavirus disease - COVID-19
    100067469 (JUN)
   05162 Measles
    100067469 (JUN)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100067469 (JUN)
   05169 Epstein-Barr virus infection
    100067469 (JUN)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    100067469 (JUN)
   05142 Chagas disease
    100067469 (JUN)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100067469 (JUN)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ecb03000]
    100067469 (JUN)
Transcription factors [BR:ecb03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Jun
    100067469 (JUN)
SSDB
Motif
Pfam: Jun bZIP_1 bZIP_2 bZIP_Maf ZapB PspA_IM30 FlaC_arch NBP1 Fib_alpha DUF3450 Jnk-SapK_ap_N TMF_DNA_bd
Other DBs
NCBI-GeneID: 100067469
NCBI-ProteinID: XP_023484655
LinkDB
Position
2
AA seq 331 aa
MTAKMETTFYDDALNASFLQSESGAYGYSNPKVLKQSMTLNLADPVGSLKPHLRAKNSDL
LTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAE
LHSQNTLPSVTSAAPPVSGAGMVAPAVASAAGGGGGGGFSASLHSEPPVYANLSNFSPGA
LGGGGAPSYGAAGLAFPAQPQPPPPPQPHHLPQQIPVQHPRLQALKEEPQTVPEMPGETP
PLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANM
LREQVAQLKQKVMNHVNSGCQLMLTQQLQTF
NT seq 996 nt   +upstreamnt  +downstreamnt
atgactgcaaagatggaaacgaccttctacgacgatgcgctcaacgcctcgttcctgcag
tccgagagcggcgcctacggctacagcaaccccaaggtcctcaagcagagcatgaccctg
aacctggccgacccggtgggcagcctgaagccgcacctccgggccaagaactcggacctg
ctcacctcgcccgacgtggggctgctcaagctggcgtcgcccgagctggagcgcctgata
atccagtccagcaacgggcacatcaccaccacgccgactcccacccagttcctgtgcccc
aagaatgtgaccgacgagcaggagggcttcgccgagggcttcgtgcgcgccctggccgaa
ctgcacagccagaacacgctgcccagcgtcacgtcggcggcgccgccggtcagcggggcg
ggcatggtggctcccgcggtggcctcggcggcgggcggcggcggcggcggcggcttcagc
gccagcctgcacagcgagccgcccgtctacgccaacctcagcaacttcagcccgggcgcg
ctgggcggcggcggggcgccctcctacggcgcggccggcctggcgttccccgcgcagccc
cagccgccgccgccgccgcagccgcaccacctgccgcagcagatccccgtgcagcacccg
cggctgcaggccctgaaggaggagccgcagacggtgcccgagatgcccggggagacgccg
cccctgtcccccatcgacatggagtcccaggagcggatcaaggcggagagaaagcgcatg
aggaaccgcatcgctgcctccaagtgccggaaaaggaagctggagaggatcgcccggctg
gaggaaaaagtgaaaaccttgaaagcgcagaactcggagctggcgtccacggccaacatg
ctcagggaacaggtggcacagcttaaacagaaagtcatgaaccacgttaacagtgggtgc
cagctcatgctaacccagcagttgcaaacgttttga

DBGET integrated database retrieval system