Equus caballus (horse): 100067469 Help Entry 100067469         CDS       T01058                                  Gene name JUN Definition (RefSeq) transcription factor AP-1   KO K04448   transcription factor AP-1 Organism ecb  Equus caballus (horse) Pathway ecb01522   Endocrine resistance ecb04010   MAPK signaling pathway ecb04012   ErbB signaling pathway ecb04024   cAMP signaling pathway ecb04137   Mitophagy - animal ecb04210   Apoptosis ecb04310   Wnt signaling pathway ecb04380   Osteoclast differentiation ecb04510   Focal adhesion ecb04530   Tight junction ecb04620   Toll-like receptor signaling pathway ecb04621   NOD-like receptor signaling pathway ecb04625   C-type lectin receptor signaling pathway ecb04657   IL-17 signaling pathway ecb04658   Th1 and Th2 cell differentiation ecb04659   Th17 cell differentiation ecb04660   T cell receptor signaling pathway ecb04662   B cell receptor signaling pathway ecb04668   TNF signaling pathway ecb04722   Neurotrophin signaling pathway ecb04912   GnRH signaling pathway ecb04915   Estrogen signaling pathway ecb04921   Oxytocin signaling pathway ecb04926   Relaxin signaling pathway ecb04932   Non-alcoholic fatty liver disease ecb04933   AGE-RAGE signaling pathway in diabetic complications ecb05030   Cocaine addiction ecb05031   Amphetamine addiction ecb05132   Salmonella infection ecb05133   Pertussis ecb05135   Yersinia infection ecb05140   Leishmaniasis ecb05142   Chagas disease ecb05161   Hepatitis B ecb05162   Measles ecb05166   Human T-cell leukemia virus 1 infection ecb05167   Kaposi sarcoma-associated herpesvirus infection ecb05169   Epstein-Barr virus infection ecb05170   Human immunodeficiency virus 1 infection ecb05171   Coronavirus disease - COVID-19 ecb05200   Pathways in cancer ecb05203   Viral carcinogenesis ecb05210   Colorectal cancer ecb05211   Renal cell carcinoma ecb05224   Breast cancer ecb05231   Choline metabolism in cancer ecb05235   PD-L1 expression and PD-1 checkpoint pathway in cancer ecb05321   Inflammatory bowel disease ecb05323   Rheumatoid arthritis ecb05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:ecb00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     100067469 (JUN)    04012 ErbB signaling pathway     100067469 (JUN)    04310 Wnt signaling pathway     100067469 (JUN)    04668 TNF signaling pathway     100067469 (JUN)    04024 cAMP signaling pathway     100067469 (JUN)  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     100067469 (JUN)   09143 Cell growth and death    04210 Apoptosis     100067469 (JUN)   09144 Cellular community - eukaryotes    04510 Focal adhesion     100067469 (JUN)    04530 Tight junction     100067469 (JUN)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     100067469 (JUN)    04621 NOD-like receptor signaling pathway     100067469 (JUN)    04625 C-type lectin receptor signaling pathway     100067469 (JUN)    04660 T cell receptor signaling pathway     100067469 (JUN)    04658 Th1 and Th2 cell differentiation     100067469 (JUN)    04659 Th17 cell differentiation     100067469 (JUN)    04657 IL-17 signaling pathway     100067469 (JUN)    04662 B cell receptor signaling pathway     100067469 (JUN)   09152 Endocrine system    04912 GnRH signaling pathway     100067469 (JUN)    04915 Estrogen signaling pathway     100067469 (JUN)    04921 Oxytocin signaling pathway     100067469 (JUN)    04926 Relaxin signaling pathway     100067469 (JUN)   09156 Nervous system    04722 Neurotrophin signaling pathway     100067469 (JUN)   09158 Development and regeneration    04380 Osteoclast differentiation     100067469 (JUN)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100067469 (JUN)    05203 Viral carcinogenesis     100067469 (JUN)    05231 Choline metabolism in cancer     100067469 (JUN)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     100067469 (JUN)   09162 Cancer: specific types    05210 Colorectal cancer     100067469 (JUN)    05211 Renal cell carcinoma     100067469 (JUN)    05224 Breast cancer     100067469 (JUN)   09163 Immune disease    05323 Rheumatoid arthritis     100067469 (JUN)    05321 Inflammatory bowel disease     100067469 (JUN)   09165 Substance dependence    05030 Cocaine addiction     100067469 (JUN)    05031 Amphetamine addiction     100067469 (JUN)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     100067469 (JUN)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     100067469 (JUN)    04933 AGE-RAGE signaling pathway in diabetic complications     100067469 (JUN)   09171 Infectious disease: bacterial    05132 Salmonella infection     100067469 (JUN)    05135 Yersinia infection     100067469 (JUN)    05133 Pertussis     100067469 (JUN)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     100067469 (JUN)    05170 Human immunodeficiency virus 1 infection     100067469 (JUN)    05161 Hepatitis B     100067469 (JUN)    05171 Coronavirus disease - COVID-19     100067469 (JUN)    05162 Measles     100067469 (JUN)    05167 Kaposi sarcoma-associated herpesvirus infection     100067469 (JUN)    05169 Epstein-Barr virus infection     100067469 (JUN)   09174 Infectious disease: parasitic    05140 Leishmaniasis     100067469 (JUN)    05142 Chagas disease     100067469 (JUN)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     100067469 (JUN)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:ecb03000]     100067469 (JUN) Transcription factors [BR:ecb03000]  Eukaryotic type   Basic leucine zipper (bZIP)    AP-1(-like) components, Jun     100067469 (JUN) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Jun bZIP_1 bZIP_2 bZIP_Maf ZapB PspA_IM30 FlaC_arch NBP1 Fib_alpha DUF3450 Jnk-SapK_ap_N TMF_DNA_bd Motif Other DBs NCBI-GeneID:  100067469 NCBI-ProteinID:  XP_023484655 LinkDB All DBs Position 2 AA seq 331 aa AA seqDB search MTAKMETTFYDDALNASFLQSESGAYGYSNPKVLKQSMTLNLADPVGSLKPHLRAKNSDL LTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAE LHSQNTLPSVTSAAPPVSGAGMVAPAVASAAGGGGGGGFSASLHSEPPVYANLSNFSPGA LGGGGAPSYGAAGLAFPAQPQPPPPPQPHHLPQQIPVQHPRLQALKEEPQTVPEMPGETP PLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANM LREQVAQLKQKVMNHVNSGCQLMLTQQLQTF NT seq 996 nt NT seq  +upstreamnt  +downstreamnt atgactgcaaagatggaaacgaccttctacgacgatgcgctcaacgcctcgttcctgcag tccgagagcggcgcctacggctacagcaaccccaaggtcctcaagcagagcatgaccctg aacctggccgacccggtgggcagcctgaagccgcacctccgggccaagaactcggacctg ctcacctcgcccgacgtggggctgctcaagctggcgtcgcccgagctggagcgcctgata atccagtccagcaacgggcacatcaccaccacgccgactcccacccagttcctgtgcccc aagaatgtgaccgacgagcaggagggcttcgccgagggcttcgtgcgcgccctggccgaa ctgcacagccagaacacgctgcccagcgtcacgtcggcggcgccgccggtcagcggggcg ggcatggtggctcccgcggtggcctcggcggcgggcggcggcggcggcggcggcttcagc gccagcctgcacagcgagccgcccgtctacgccaacctcagcaacttcagcccgggcgcg ctgggcggcggcggggcgccctcctacggcgcggccggcctggcgttccccgcgcagccc cagccgccgccgccgccgcagccgcaccacctgccgcagcagatccccgtgcagcacccg cggctgcaggccctgaaggaggagccgcagacggtgcccgagatgcccggggagacgccg cccctgtcccccatcgacatggagtcccaggagcggatcaaggcggagagaaagcgcatg aggaaccgcatcgctgcctccaagtgccggaaaaggaagctggagaggatcgcccggctg gaggaaaaagtgaaaaccttgaaagcgcagaactcggagctggcgtccacggccaacatg ctcagggaacaggtggcacagcttaaacagaaagtcatgaaccacgttaacagtgggtgc cagctcatgctaacccagcagttgcaaacgttttga

DBGET integrated database retrieval system