KEGG   Equus caballus (horse): 100067755
Entry
100067755         CDS       T01058                                 

Gene name
EGFR
Definition
(RefSeq) epidermal growth factor receptor isoform X1
  KO
K04361  epidermal growth factor receptor [EC:2.7.10.1]
Organism
ecb  Equus caballus (horse)
Pathway
ecb01521  EGFR tyrosine kinase inhibitor resistance
ecb01522  Endocrine resistance
ecb04010  MAPK signaling pathway
ecb04012  ErbB signaling pathway
ecb04014  Ras signaling pathway
ecb04015  Rap1 signaling pathway
ecb04020  Calcium signaling pathway
ecb04066  HIF-1 signaling pathway
ecb04068  FoxO signaling pathway
ecb04072  Phospholipase D signaling pathway
ecb04144  Endocytosis
ecb04151  PI3K-Akt signaling pathway
ecb04510  Focal adhesion
ecb04520  Adherens junction
ecb04540  Gap junction
ecb04630  JAK-STAT signaling pathway
ecb04810  Regulation of actin cytoskeleton
ecb04912  GnRH signaling pathway
ecb04915  Estrogen signaling pathway
ecb04921  Oxytocin signaling pathway
ecb04926  Relaxin signaling pathway
ecb04928  Parathyroid hormone synthesis, secretion and action
ecb04934  Cushing syndrome
ecb05160  Hepatitis C
ecb05163  Human cytomegalovirus infection
ecb05165  Human papillomavirus infection
ecb05171  Coronavirus disease - COVID-19
ecb05200  Pathways in cancer
ecb05205  Proteoglycans in cancer
ecb05206  MicroRNAs in cancer
ecb05210  Colorectal cancer
ecb05212  Pancreatic cancer
ecb05213  Endometrial cancer
ecb05214  Glioma
ecb05215  Prostate cancer
ecb05218  Melanoma
ecb05219  Bladder cancer
ecb05223  Non-small cell lung cancer
ecb05224  Breast cancer
ecb05225  Hepatocellular carcinoma
ecb05226  Gastric cancer
ecb05230  Central carbon metabolism in cancer
ecb05231  Choline metabolism in cancer
ecb05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100067755 (EGFR)
   04012 ErbB signaling pathway
    100067755 (EGFR)
   04014 Ras signaling pathway
    100067755 (EGFR)
   04015 Rap1 signaling pathway
    100067755 (EGFR)
   04630 JAK-STAT signaling pathway
    100067755 (EGFR)
   04066 HIF-1 signaling pathway
    100067755 (EGFR)
   04068 FoxO signaling pathway
    100067755 (EGFR)
   04020 Calcium signaling pathway
    100067755 (EGFR)
   04072 Phospholipase D signaling pathway
    100067755 (EGFR)
   04151 PI3K-Akt signaling pathway
    100067755 (EGFR)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100067755 (EGFR)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100067755 (EGFR)
   04520 Adherens junction
    100067755 (EGFR)
   04540 Gap junction
    100067755 (EGFR)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100067755 (EGFR)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    100067755 (EGFR)
   04915 Estrogen signaling pathway
    100067755 (EGFR)
   04921 Oxytocin signaling pathway
    100067755 (EGFR)
   04926 Relaxin signaling pathway
    100067755 (EGFR)
   04928 Parathyroid hormone synthesis, secretion and action
    100067755 (EGFR)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100067755 (EGFR)
   05206 MicroRNAs in cancer
    100067755 (EGFR)
   05205 Proteoglycans in cancer
    100067755 (EGFR)
   05230 Central carbon metabolism in cancer
    100067755 (EGFR)
   05231 Choline metabolism in cancer
    100067755 (EGFR)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100067755 (EGFR)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100067755 (EGFR)
   05212 Pancreatic cancer
    100067755 (EGFR)
   05225 Hepatocellular carcinoma
    100067755 (EGFR)
   05226 Gastric cancer
    100067755 (EGFR)
   05214 Glioma
    100067755 (EGFR)
   05218 Melanoma
    100067755 (EGFR)
   05219 Bladder cancer
    100067755 (EGFR)
   05215 Prostate cancer
    100067755 (EGFR)
   05213 Endometrial cancer
    100067755 (EGFR)
   05224 Breast cancer
    100067755 (EGFR)
   05223 Non-small cell lung cancer
    100067755 (EGFR)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100067755 (EGFR)
  09172 Infectious disease: viral
   05160 Hepatitis C
    100067755 (EGFR)
   05171 Coronavirus disease - COVID-19
    100067755 (EGFR)
   05163 Human cytomegalovirus infection
    100067755 (EGFR)
   05165 Human papillomavirus infection
    100067755 (EGFR)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100067755 (EGFR)
   01522 Endocrine resistance
    100067755 (EGFR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ecb01001]
    100067755 (EGFR)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ecb04147]
    100067755 (EGFR)
Enzymes [BR:ecb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100067755 (EGFR)
Protein kinases [BR:ecb01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   100067755 (EGFR)
Exosome [BR:ecb04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   100067755 (EGFR)
  Exosomal proteins of pancreatic cancer cells
   100067755 (EGFR)
  Exosomal proteins of bladder cancer cells
   100067755 (EGFR)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Pkinase Furin-like APH Borrelia_P83 Kinase-like Kdo
Other DBs
NCBI-GeneID: 100067755
NCBI-ProteinID: XP_023494835
Ensembl: ENSECAG00000009952
VGNC: 17460
LinkDB
Position
4
AA seq 1209 aa
MRHSGTVGAALLVLLAAYFQASPALEEKKVCQGTSNRLTQLGTFEDHFLSLQRMFNNCEV
VLGNLEITYMQKNYDLSFLKTIQEVAGYVLIALNTVEKIPLENLQIIRGNVLYENTHALS
VLSNYGANKVGLRELPMRNLQEILQGAVRFSNNPILCNMETIQWRDIVNSDFLSNMSVDF
QNQLGSCQKCDPACPNGSCWGVGKENCQKLTKTICAQQCSGRCRGRSPSDCCHNQCAAGC
TGPRESDCLVCRKFRDEATCKDTCPPLMLYNPTTYQMDVNPDGKYSFGATCVKKCPRNYV
VTDHGSCVRACSSDSYEVEEDGVRKCKKCEGPCRKVCNGIGIGEFKDTLSINATNIKHFK
NCTSISGDLHILPVAFRGDSFTRTPPLDPKELDILQTVKEITGFLLIQAWPENRTDLHAF
ENLEIIRGRTKQHGQFSLAVVGLDITSLGLRSLKEISDGDVIISGNRNLCYANTIKWKKL
FGTSSQKTKIINNRSEKDCKTVGHVCNLLCSSEGCWGPEPRDCVSCQNVSRGKECVEKCN
ILEGEPREFVENSECIQCHPECLPQAMNITCTGRGPDNCIKCAHYIDGPHCVKTCPSGIM
GENNTLVWKFADANHVCHLCHPNCTYGCAGPGLEGCARNGPKIPSIATGIVGGLLLVVVV
ALGIGLFLRRRHIVRKRTLRRLLQERELVEPLTPSGEAPNQALLRILKETEFKKIKVLGS
GAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASVDNPHVCRLLGI
CLTSTVQLITQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAA
RNVLVKTPQHVKITDFGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVWSY
GVTVWELMTFGSKPYDGIPASEISTILEKGERLPQPPICTIDVYMIMVKCWMIDADSRPK
FRELIIEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYRTLMDEEDMEDVVDADEYLIPQ
QGFFHSPSTSRTPLISSLSATSNNSTVACIDRNGQSCPLKEDSFLQRYSSDPTGTVTEDN
IDDTFLPAPEYVNQSVPKRPAGSVQNPVYHNQPLNPAPGRDPHYQNPHSNAMDNPEYLNT
THPDCVNSVLDGTALWAQKGNHQISLDNPDYQQDFFPKEAKSNGIFKGPAAENAEYLRVA
PPSSEFIGA
NT seq 3630 nt   +upstreamnt  +downstreamnt
atgcgacattcagggaccgtcggcgccgcgctcctggtgctgctggctgcgtacttccag
gcgagtccggcgctggaggagaagaaagtttgccaaggcacaagtaacaggctcacgcag
ttgggcacttttgaggaccactttctgagcctccagagaatgttcaataactgtgaggtg
gtcctcgggaatttggaaattacctacatgcaaaagaattatgacctttccttcttaaag
accatacaggaggttgctggctatgtactcattgccctcaacacagtggagaagattcct
ttggaaaatctgcagatcatcagaggaaatgtgctgtatgaaaacacccatgccttatca
gtcttatccaactatggtgcaaataaagtcggactgagggagcttcctatgaggaactta
caggaaatcctgcagggtgctgtacgattcagcaacaaccctatcctctgcaacatggag
actatccagtggcgggacattgtcaacagtgattttctaagcaatatgtcagtggacttt
cagaatcaactgggcagttgccaaaagtgtgatccagcctgccccaatggaagctgttgg
ggtgtgggaaaggagaactgccagaaattgaccaagaccatctgtgcccagcagtgttca
gggcgctgccgtggcaggtcccccagcgactgctgccacaaccagtgtgccgccggctgc
acagggccccgggagagtgactgcctggtctgccgaaaattccgggatgaagccacgtgc
aaggacacctgcccaccactcatgctttacaaccccaccacgtaccagatggacgtcaac
ccagatggaaaatacagcttcggtgccacctgtgtgaagaaatgcccccgtaactatgtg
gtgacagaccacggttcctgtgtccgcgcctgcagttctgacagctacgaggtggaggaa
gacggagtccgcaaatgtaaaaagtgtgaagggccttgtcgcaaagtttgtaatggaata
ggaattggtgaatttaaagacacactttccataaatgctaccaatattaaacacttcaaa
aattgtacctcgatcagtggagatcttcatatcctgccggtagcatttaggggtgactcc
ttcacacggaccccgcctctggatcccaaggagctggatattctacaaacggtgaaggag
ataacagggtttttgctgattcaggcctggccagaaaacaggactgacctccatgctttc
gagaacctggaaatcatacgtggcagaaccaagcaacatggtcagttttctcttgcggtc
gtcggcctggacattacatctttgggattacgctccctcaaggagataagtgatggagat
gtgatcatttcagggaaccgaaacttatgttatgcaaatacaataaaatggaaaaaactg
tttgggacctcaagtcagaaaaccaaaattataaacaacagaagtgaaaaagactgcaag
accgttggccatgtctgtaatctgttatgctcgtcagagggctgctggggcccagagccc
agagactgcgtgtcctgccagaacgtcagccgtggcaaagaatgtgtagagaagtgcaac
attctggaaggcgagccaagggagtttgtggagaattccgagtgcatacagtgccatcca
gaatgcctgccccaggccatgaatataacctgcacaggacgtggcccagacaactgcata
aagtgtgctcactacatcgatggccctcactgtgtcaagacctgcccgtctggaatcatg
ggagaaaacaataccctggtctggaagtttgcggatgccaatcacgtgtgtcacctgtgc
catccaaactgtacctacggctgtgctgggccaggcctcgaaggctgtgcaagaaatggg
cccaagatcccatccatcgctactgggattgtgggcggcctcctcctggtggtggtggta
gcccttgggattggcctctttttgcgcaggcggcacatcgtccggaagcgcactctgcgc
agactcctgcaggaaagagagctcgtcgagcctcttacacccagcggagaagctccgaac
caagctctcttgaggatcttaaaggaaaccgaattcaaaaagatcaaggtgctaggttct
ggagcattcggcacagtgtacaaggggctctggatcccagaaggtgagaaggttaaaatt
cctgtggctatcaaggaattaagagaagccacgtctccaaaagccaacaaggaaattctt
gatgaagcctatgtgatggccagtgtggacaaccctcacgtgtgtcgccttctgggcatc
tgcctgacctccacagtccagctcatcacgcagctcatgcctttcggctgcctcctggac
tatgtccgtgagcacaaggacaacattggctcccagtacctgctcaactggtgtgtgcag
attgcaaagggcatgaactacctggaagaccggcgcttggtgcaccgtgacctggcagcc
aggaacgtcctggtgaaaacaccacagcatgtcaagatcacagattttgggctggccaaa
ctgcttggtgcggaggaaaaagaataccacgcagaaggaggcaaagtacctatcaagtgg
atggctttagaatcaattttgcaccgaatttatacccaccaaagtgatgtctggagctat
ggagtcaccgtttgggaactgatgacctttgggtccaagccttatgacggaattcccgca
agtgagatctcaaccatcctggagaaaggggagcgcctcccgcagccgcccatatgtacc
atcgatgtctacatgatcatggtcaagtgctggatgatagatgcagatagtcgcccaaag
ttccgtgagttgatcattgaattctccaaaatggccagagacccccagcgctaccttgtc
atccagggggatgagagaatgcatttgccaagccctacagactccaacttttatcgcacc
ctgatggatgaagaggacatggaagatgtcgttgatgccgatgagtacctcatcccacag
cagggcttcttccacagtccctccacatcccggacacccctcataagttctctgagtgcc
accagcaataattccactgtggcttgcattgatagaaacgggcagagctgtcccctcaag
gaagacagcttcttgcagcggtacagctcagaccccactggcaccgtgactgaggacaac
atagatgacactttcctcccggcgcctgagtacgtaaaccaatccgttcccaaaaggccc
gcaggttctgtccagaaccctgtctatcacaatcagcctctaaatccagctcctggcaga
gatcctcactatcaaaatccccacagcaatgcgatggacaaccctgagtacctcaacacc
acccatcctgactgcgtcaacagtgtgctcgatggtactgccctctgggcacagaaaggc
aatcaccaaattagcctggacaaccctgactaccagcaggacttctttcccaaggaagcc
aagtcaaatggcatctttaagggtcctgcagctgaaaatgcagaatacctaagggtagca
ccaccaagcagtgaatttattggagcatga

DBGET integrated database retrieval system