KEGG   Equus caballus (horse): 100068097
Entry
100068097         CDS       T01058                                 

Gene name
MYC
Definition
(RefSeq) myc proto-oncogene protein
  KO
K04377  Myc proto-oncogene protein
Organism
ecb  Equus caballus (horse)
Pathway
ecb04010  MAPK signaling pathway
ecb04012  ErbB signaling pathway
ecb04110  Cell cycle
ecb04151  PI3K-Akt signaling pathway
ecb04218  Cellular senescence
ecb04310  Wnt signaling pathway
ecb04350  TGF-beta signaling pathway
ecb04390  Hippo signaling pathway
ecb04550  Signaling pathways regulating pluripotency of stem cells
ecb04630  JAK-STAT signaling pathway
ecb04919  Thyroid hormone signaling pathway
ecb05132  Salmonella infection
ecb05160  Hepatitis C
ecb05161  Hepatitis B
ecb05163  Human cytomegalovirus infection
ecb05166  Human T-cell leukemia virus 1 infection
ecb05167  Kaposi sarcoma-associated herpesvirus infection
ecb05169  Epstein-Barr virus infection
ecb05200  Pathways in cancer
ecb05202  Transcriptional misregulation in cancer
ecb05205  Proteoglycans in cancer
ecb05206  MicroRNAs in cancer
ecb05210  Colorectal cancer
ecb05213  Endometrial cancer
ecb05216  Thyroid cancer
ecb05219  Bladder cancer
ecb05220  Chronic myeloid leukemia
ecb05221  Acute myeloid leukemia
ecb05222  Small cell lung cancer
ecb05224  Breast cancer
ecb05225  Hepatocellular carcinoma
ecb05226  Gastric cancer
ecb05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100068097 (MYC)
   04012 ErbB signaling pathway
    100068097 (MYC)
   04310 Wnt signaling pathway
    100068097 (MYC)
   04350 TGF-beta signaling pathway
    100068097 (MYC)
   04390 Hippo signaling pathway
    100068097 (MYC)
   04630 JAK-STAT signaling pathway
    100068097 (MYC)
   04151 PI3K-Akt signaling pathway
    100068097 (MYC)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100068097 (MYC)
   04218 Cellular senescence
    100068097 (MYC)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100068097 (MYC)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    100068097 (MYC)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100068097 (MYC)
   05202 Transcriptional misregulation in cancer
    100068097 (MYC)
   05206 MicroRNAs in cancer
    100068097 (MYC)
   05205 Proteoglycans in cancer
    100068097 (MYC)
   05230 Central carbon metabolism in cancer
    100068097 (MYC)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100068097 (MYC)
   05225 Hepatocellular carcinoma
    100068097 (MYC)
   05226 Gastric cancer
    100068097 (MYC)
   05216 Thyroid cancer
    100068097 (MYC)
   05221 Acute myeloid leukemia
    100068097 (MYC)
   05220 Chronic myeloid leukemia
    100068097 (MYC)
   05219 Bladder cancer
    100068097 (MYC)
   05213 Endometrial cancer
    100068097 (MYC)
   05224 Breast cancer
    100068097 (MYC)
   05222 Small cell lung cancer
    100068097 (MYC)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100068097 (MYC)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100068097 (MYC)
   05161 Hepatitis B
    100068097 (MYC)
   05160 Hepatitis C
    100068097 (MYC)
   05163 Human cytomegalovirus infection
    100068097 (MYC)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100068097 (MYC)
   05169 Epstein-Barr virus infection
    100068097 (MYC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ecb03000]
    100068097 (MYC)
   03019 Messenger RNA biogenesis [BR:ecb03019]
    100068097 (MYC)
Transcription factors [BR:ecb03000]
 Eukaryotic type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Cell cycle controlling factors, Myc
    100068097 (MYC)
Messenger RNA biogenesis [BR:ecb03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     100068097 (MYC)
SSDB
Motif
Pfam: Myc_N HLH Myc-LZ
Other DBs
NCBI-GeneID: 100068097
NCBI-ProteinID: XP_001498041
Ensembl: ENSECAG00000022059
VGNC: 20467
UniProt: A0A3Q2I924
LinkDB
Position
9
AA seq 437 aa
MPLNVSFASRNYDLDYDSVQPYFYCDEDENFYQQQQQSELQPPAPSEDIWKKFELLPTPP
LSPSRRSGFCSPSYVAVASFSPRGDDDGGGGSFSTADQLEMVTELLGGDMVNQSFICDPD
DETFIKNIIIQDCMWSGFSAAAKLVSEKLASFQAARKDSGSPSPARGPGGCSTSSLYLQD
LSAAASECIDPSVVFPYPLNDGSSPKPCASPDSTAFSSSSDSLLSSAESSPRASPEPLTL
HEETPPTTSSDSEEEQEDEEEIDVVSVEKRQPPAKRSESGSPSAGGHSKPPHSPLVLKRC
HVSTHQHNYAAPPSTRKDYPAAKRAKLDSGRVLKQISNNRKCTSPRSSDTEENDKRRTHN
VLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATVFILSVQAEEQKLVSEKDLL
RKRREHLQLKLEQLRNC
NT seq 1314 nt   +upstreamnt  +downstreamnt
atgcccctcaacgtcagcttcgccagcaggaactatgacctcgactacgactcggtgcag
ccctatttctactgcgacgaagacgagaacttctaccagcagcagcagcagagcgagctg
cagcccccggctcccagcgaggatatctggaagaaattcgagctgctgcccaccccgccc
ctgtccccgagccgccgctccgggttctgctcgccctcctatgtcgcggtggcgtccttc
tctcccaggggagacgacgacggcggcggcggcagcttttccacggccgaccagttggag
atggtgaccgagctgctgggaggagatatggtgaaccagagcttcatctgcgacccggac
gacgagaccttcatcaaaaacatcatcatccaggactgtatgtggagcggcttctcggcc
gctgccaagctggtctcagagaagctggcctccttccaggctgcgcgcaaagacagcggc
agcccgagccccgcccgcgggcccggcggctgctccacctccagcttgtacctgcaggac
ctgagcgccgccgcctccgaatgcatcgacccctccgtggtcttcccctacccgctcaac
gacggtagctcgcccaagccctgcgcctcccccgactccaccgccttctcttcgtcctcg
gactctctgctctcctcggccgagtcctccccgcgggccagccccgagcccctgacgctc
cacgaggagacaccccccaccaccagcagcgactctgaagaagaacaagaggatgaggaa
gaaattgatgttgtttctgtggaaaagaggcagccccctgccaaaaggtcagaatcgggg
tcaccctctgcaggaggccacagcaaacctcctcacagccccctggtccttaagcgatgc
cacgtgtccacccaccagcacaattacgcagctcccccctccactaggaaggactatcct
gccgccaagagggctaagttggacagtggcagggtcctgaaacagatcagcaacaaccgg
aaatgtaccagccccaggtcttcggacacagaggagaatgacaagaggaggacacacaac
gtcctggaacgccagaggagaaatgagctgaaaaggagcttttttgccctgcgagaccag
atccctgagttggaaaataatgaaaaagctcctaaagtagttatccttaaaaaagccacc
gtatttatcttgtcagtccaggcagaggagcagaagctcgtttcagaaaaggatttactg
aggaagcgacgagaacatttgcagcttaaacttgaacagctacggaactgttga

DBGET integrated database retrieval system