KEGG   Equus caballus (horse): 100068666Help
Entry
100068666         CDS       T01058                                 

Gene name
CARD9
Definition
(RefSeq) caspase recruitment domain-containing protein 9 isoform X1
  KO
K12794  caspase recruitment domain-containing protein 9
Organism
ecb  Equus caballus (horse)
Pathway
ecb04621  NOD-like receptor signaling pathway
ecb04625  C-type lectin receptor signaling pathway
ecb05152  Tuberculosis
ecb05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100068666 (CARD9)
   04625 C-type lectin receptor signaling pathway
    100068666 (CARD9)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100068666 (CARD9)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    100068666 (CARD9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CARD CARD_2 KASH_CCD CxC5 NBD_C
Motif
Other DBs
NCBI-GeneID: 100068666
NCBI-ProteinID: XP_001496266
Ensembl: ENSECAG00000019300
VGNC: 16055
UniProt: F6UIA3
LinkDB All DBs
Position
25
AA seq 537 aa AA seqDB search
MSDYENEDECWSTLEGFRVKLISVIDPSRITPYLRQCKVLNPDDEEQVLSDPNLVIRKRK
VGVLLDILQRTGHKGYVAFLESLELYYPQLYKKVTGKEPTRVFSMIIDASGESGLTQLLM
SEVMKLQKKVQDLTALLSSKDDFIKELRVKDSLLRKHQERVQRLKEECEAGSRELKRCKD
ENYDLALRLARQSEEKGAALMRNRDLQLEIDRLKHSLMKAEDDCKVERKHTLKLRHAMEQ
RPSQELLWELQQEKALLQARVQELEASVQEGKPDRGSPYIQVLEEDWRQALRDHQEQAST
IFSLRKDLRQAEALRARCMEEKEMFELQCLALRKDSKMYKDRIEAILQQMEEVAIERDQA
ITTREELHTQHARSLQEKDGLRKRVRELGEKADELQLQLFQCEGQLLAAEGRLKRQQLEM
LVLSSDLEDSSPRNSQELSLPRDLEEDAQLSDKGGPADRESPEEPFAALQKERLSLTPKD
AGRSGGEPPEKERRRLKESFENYRRKRALRKMQHGWRQGEVDWENTTGSDNTDTEGS
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atgtcggactatgagaacgaggacgagtgctggagcaccctggagggcttccgggtgaag
ctcatctcggtcatcgacccctcgcgcatcacgccctacctgaggcagtgcaaggtcctg
aaccctgacgacgaggagcaggtgctcagcgaccccaacctggtcatccgcaagcgcaaa
gtgggcgtgctcctggacatcctgcaacggactggccacaagggctacgtggccttcctc
gagagcctggagctctactacccgcagctgtacaagaaggtcacgggcaaggagcccacc
cgcgtcttctccatgatcattgacgcgtctggggagtcgggcctgacacagctgctgatg
agcgaggtgatgaagctgcagaagaaggtgcaggacctgacggcgctgctgagctccaag
gacgacttcatcaaggagctgcgggtgaaggacagcctgctgcgcaagcaccaggagcgt
gtgcagaggctcaaggaggagtgcgaggctggcagccgggagctcaagcgctgcaaggac
gagaactacgacctggccctgcgcctggcccgccagagcgaggagaagggcgccgcgctc
atgcgcaaccgagacctgcagctggagatcgaccggctcaagcacagcctcatgaaggcg
gaggatgactgcaaggtggagcgcaagcacacactgaagctcaggcacgccatggagcag
cggcccagccaggagctgctgtgggagctgcagcaggagaaggccctcctgcaggcccgg
gtgcaggagctggaggcctctgtccaggaggggaagccagacaggggcagcccctacatc
caggtgctggaggaagattggaggcaggcgcttcgggaccaccaggagcaggccagcacc
atcttctccctgcgcaaggacctgcgccaggctgaggccctgcgcgcccggtgcatggag
gagaaggagatgtttgagcttcagtgcctggccctgcggaaggactccaagatgtacaag
gaccgcatcgaggccatcctgcagcagatggaggaggtcgccatcgagcgggaccaggcc
atcacgacgcgggaggagctgcacacgcagcacgcccggagcctgcaggagaaggacggg
ctgcggaagcgggtgcgggagctgggcgagaaggccgacgagctgcagctgcagctgttc
cagtgcgagggccagctgctggccgcggagggcaggctcaagcggcagcagctggagatg
ctcgtcctgagctccgacctagaggacagctcacccaggaactcccaggagctctcgctg
ccccgggatctggaggaggacgcccagctctcggacaaaggtggcccggcagaccgggag
agcccagaggagccctttgcagccctgcaaaaggagcggctttcactgacccccaaggac
gcgggcaggagcggcggagagcccccggagaaggagcggcggcgcctcaaggagagcttc
gagaactaccgcaggaagcgcgcgctcaggaagatgcagcacggctggagacagggggag
gtggactgggagaacaccacgggcagcgacaacacggacaccgagggctcctag

DBGET integrated database retrieval system