KEGG   Equus caballus (horse): 100070046Help
Entry
100070046         CDS       T01058                                 

Gene name
TGM2
Definition
(RefSeq) protein-glutamine gamma-glutamyltransferase 2
  KO
K05625  transglutaminase 2 [EC:2.3.2.13]
Organism
ecb  Equus caballus (horse)
Pathway
ecb05016  Huntington's disease
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Human Diseases
  Neurodegenerative diseases
   05016 Huntington's disease
    100070046 (TGM2)
Enzymes [BR:ecb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     100070046 (TGM2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_C Transglut_N Transglut_core A2M_N
Motif
Other DBs
NCBI-GeneID: 100070046
NCBI-ProteinID: XP_005604684
Ensembl: ENSECAG00000006290
VGNC: 24061
LinkDB All DBs
Position
22
AA seq 687 aa AA seqDB search
MAQDLILGRCDLELEANGRDHYTADLCRERLVVRRGQPFRVTLHFEGRNYEASVDSLTFS
VVTGPAPSEEAGTKARFPLSDAVDEGAWTALVVDQQDSALSLQLSTPANAPIGLYRLSLE
ASTGYEGSSFVLGHFTLLFNPWCPADAVYLDSEQEREEYVLTQQGFIYQGSAKFIKGIPW
NFGQFEDGILDICLMLLDINPKFLRDASRDCSRRSSPVYVGRVVSGMVNCNDDQGVLLGR
WDNNYGDGISPMFWIGSVDILRRWKSCGCQRVKYGQCWVFAAVACTVLRCLGIPTRVVTN
YNSAHDQNSNLLIEYFRNEFGEIQKDKSEMIWNFHCWVESWMTRPDLQPGYEGWQALDPT
PQEKSEGTYCCGPVPVRAIKEGDLSTKYDAPFVFAEVNADVVDWIRQEDGSLHKSVNRSL
VVGLQISTKSVGRDEREDITHNYKYPEGSPEEREAFTRANHLNKLADKEETGIAMRIRVS
QSMSMGSDFDVFAYITNNTAEDHACRLLLCARTVSYNGVLGPECGAKDLLNLSLEPFSEK
SIPLRILYKKYCDCLTESNLIKVRGLLIEPAANNYLLAERDIYLENPEIKIRILGEPKQN
RKLVAEVSLRNPLAVPLLGCTFTVEGAGLTEEQKTMEIPDPVEAGQEVKVRVDLLPLHVG
RHKLVVNFESDKLKAVKGFRNVIIGPS
NT seq 2064 nt NT seq  +upstreamnt  +downstreamnt
atggcccaggatctgattctggggagatgtgacctggagctggaggccaatggccgtgac
cactacacggccgacctgtgccgggagaggctggtggtgcggcgcggccagcccttccgg
gtgacgttgcacttcgagggccgaaactacgaggccagtgtggacagcctcaccttcagt
gttgtgacgggcccagcccccagtgaggaggcagggaccaaggcccgcttcccgctgtcc
gacgctgtggacgagggtgcctggacggccttggtggtggaccagcaggacagcgccctc
tcgctgcagctcagcaccccagccaacgcccccatcggcctgtaccgcctcagcctggag
gcctccactggctatgagggctccagcttcgtgctgggccatttcaccctgctcttcaac
ccctggtgcccagccgacgctgtgtacctggactcggagcaggagcgagaggagtacgtc
ctcacccagcagggcttcatctaccagggctcggccaagttcatcaagggcataccctgg
aacttcgggcagtttgaagatgggatcctggacatctgcctgatgctcctggacatcaac
cccaagttcctgagggacgccagccgcgactgctcgcgccgcagcagccccgtctacgtg
ggccgggtggtgagcggcatggtcaactgcaacgatgaccagggcgtgctgctgggacgc
tgggacaacaactacggggacggcatcagccccatgttctggatcggcagtgtggacatc
ctgcggcgctggaagagctgcggctgccagcgtgtcaagtatggccagtgctgggtcttc
gcggctgtggcctgcacagtgctgcgctgcctcggcatccccacccgcgtcgtgaccaac
tataactctgcccacgaccagaacagcaacctgctcatcgagtacttccgcaacgagttt
ggggagatccagaaggacaagagcgagatgatctggaacttccactgctgggtggagtcc
tggatgaccaggccggacctgcagccagggtacgaggggtggcaggccctcgaccccacg
ccccaggagaagagcgaagggacatactgctgcggcccagttccggtccgtgccatcaag
gagggcgacctgagcaccaagtacgacgccccttttgtcttcgccgaggtcaatgccgac
gtggtggactggatccggcaggaggatgggtccctgcacaagtccgtcaaccgctcgctg
gtggtggggctgcagatcagcacaaagagcgtgggccgcgacgagcgggaagacatcacc
cacaactacaagtaccccgaggggtccccggaggagagggaagccttcacgagggccaac
catctgaacaagctggctgacaaagaggagaccggcatcgccatgcgcatccgcgtgagc
cagagcatgagcatgggcagtgacttcgacgtctttgcctacatcaccaacaacacggcc
gaagaccacgcttgccgcctcctgctctgcgcccgcaccgtcagctacaacggggtcctg
gggcccgagtgtggcgccaaggacctcctcaacctttccctggagcccttctctgagaag
agcatccctcttcgaatcctctataagaaatactgcgactgcctgaccgaatcgaacctc
atcaaggtgcgcggcctcctcatcgagcccgctgccaacaactaccttctggccgagagg
gacatctatttggagaacccagaaatcaagatccggatcctgggggagcccaagcagaac
cgcaagctggtggctgaggtgtccctgcggaacccgctggccgtgcccctgttgggctgc
accttcaccgtggagggggcgggcctgaccgaggagcagaagaccatggagatcccggac
ccagtggaggccgggcaggaagtgaaggtgagggtggacctgctgccgctgcacgtggga
cgccacaagctggtggtgaacttcgagagcgacaagctgaaagctgtgaagggtttcagg
aacgtcatcatcggcccctcttaa

DBGET integrated database retrieval system