KEGG   Equus caballus (horse): 100070283
Entry
100070283         CDS       T01058                                 

Gene name
PDGFB
Definition
(RefSeq) platelet-derived growth factor subunit B isoform X1
  KO
K17386  platelet-derived growth factor subunit B
Organism
ecb  Equus caballus (horse)
Pathway
ecb01521  EGFR tyrosine kinase inhibitor resistance
ecb04010  MAPK signaling pathway
ecb04014  Ras signaling pathway
ecb04015  Rap1 signaling pathway
ecb04020  Calcium signaling pathway
ecb04072  Phospholipase D signaling pathway
ecb04151  PI3K-Akt signaling pathway
ecb04510  Focal adhesion
ecb04540  Gap junction
ecb04630  JAK-STAT signaling pathway
ecb04810  Regulation of actin cytoskeleton
ecb05167  Kaposi sarcoma-associated herpesvirus infection
ecb05200  Pathways in cancer
ecb05206  MicroRNAs in cancer
ecb05211  Renal cell carcinoma
ecb05214  Glioma
ecb05215  Prostate cancer
ecb05218  Melanoma
ecb05231  Choline metabolism in cancer
ecb05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100070283 (PDGFB)
   04014 Ras signaling pathway
    100070283 (PDGFB)
   04015 Rap1 signaling pathway
    100070283 (PDGFB)
   04630 JAK-STAT signaling pathway
    100070283 (PDGFB)
   04020 Calcium signaling pathway
    100070283 (PDGFB)
   04072 Phospholipase D signaling pathway
    100070283 (PDGFB)
   04151 PI3K-Akt signaling pathway
    100070283 (PDGFB)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100070283 (PDGFB)
   04540 Gap junction
    100070283 (PDGFB)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100070283 (PDGFB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100070283 (PDGFB)
   05206 MicroRNAs in cancer
    100070283 (PDGFB)
   05231 Choline metabolism in cancer
    100070283 (PDGFB)
  09162 Cancer: specific types
   05214 Glioma
    100070283 (PDGFB)
   05218 Melanoma
    100070283 (PDGFB)
   05211 Renal cell carcinoma
    100070283 (PDGFB)
   05215 Prostate cancer
    100070283 (PDGFB)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100070283 (PDGFB)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    100070283 (PDGFB)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100070283 (PDGFB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ecb04052]
    100070283 (PDGFB)
   00536 Glycosaminoglycan binding proteins [BR:ecb00536]
    100070283 (PDGFB)
Cytokines and growth factors [BR:ecb04052]
 Growth factors
  Growth factors (RTK binding)
   100070283 (PDGFB)
Glycosaminoglycan binding proteins [BR:ecb00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100070283 (PDGFB)
SSDB
Motif
Pfam: PDGF PDGF_N
Other DBs
NCBI-GeneID: 100070283
NCBI-ProteinID: XP_023486879
LinkDB
Position
28
AA seq 242 aa
MNRCWALFLSLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHGDSVDEDGAEL
DLNLTRSHAGGEPDSLSRGRRSLGSLAVAEPAMIAECKTRTEVFEISRRLIDRTNANFLV
WPPCVEVQRCSGCCNNRHVQCRPTQVQLRPVQVRKIEIVRKKPTFKKATVTLEDHLACKC
ETVGAARPVTRNPGSSQEQRAAKTPQTRVTIRTVRVRRPPKGKHRKFKHTHDKKALKETL
GA
NT seq 729 nt   +upstreamnt  +downstreamnt
atgaatcgttgctgggcgctcttcctgtctctctgctgctacctgcgtctggtcagcgcc
gagggggaccccattcctgaggagctctacgagatgctgagcgaccactcgatccgctcc
ttcgatgacctccagcgcctgctgcacggagactccgtagatgaagacggggccgagctg
gacctgaatctgacgcggtcccatgctggaggcgagccggacagcttatcccgcgggaga
aggagcctaggttccctggccgttgccgagccagccatgatcgccgagtgcaagactcgc
accgaggtgttcgagatctcccggcgcctcatcgaccgcaccaacgccaacttcctggtg
tggccgccctgcgtggaggtccagcgctgctccggctgctgcaacaaccgccacgtgcag
tgccggcccacccaggtgcagctgcggcccgtgcaggtgagaaagatcgagatcgtgcgg
aagaagccgacattcaagaaggccacagtgactctggaagaccacctggcctgcaagtgt
gagacggtgggggccgcacgacccgtgacccgaaaccccgggagttcccaggagcagcga
gcagccaagacgcctcaaactcgggtgaccattcggacggtgcgcgtccgccggcccccc
aaggggaagcaccggaagttcaagcacacacatgacaagaaggcactgaaggagaccctc
ggagcctag

DBGET integrated database retrieval system