KEGG   Equus caballus (horse): 100070756Help
Entry
100070756         CDS       T01058                                 

Gene name
PBX3
Definition
(RefSeq) pre-B-cell leukemia transcription factor 3 isoform X1
  KO
K15610  pre-B-cell leukemia transcription factor 3
Organism
ecb  Equus caballus (horse)
Pathway
ecb05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    100070756 (PBX3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ecb03000]
    100070756 (PBX3)
Transcription factors [BR:ecb03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, PBC
    100070756 (PBX3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PBC Homeodomain Homeobox_KN YdaS_antitoxin Sec15 LZ3wCH
Motif
Other DBs
NCBI-GeneID: 100070756
NCBI-ProteinID: XP_023484652
LinkDB All DBs
Position
25
AA seq 434 aa AA seqDB search
MDDQSRMLQTLAGVNLAGHSVQGGMALPPPPHGHEGADGDGRKQDIGDILHQIMTITDQS
LDEAQAKKHALNCHRMKPALFSVLCEIKEKTGLSIRGAQEEDPPDPQLMRLDNMLLAEGV
SGPEKGGGSAAAAAAAAASGGSSDNSIEHSDYRAKLTQIRQIYHTELEKYEQACNEFTTH
VMNLLREQSRTRPISPKEIERMVGIIHRKFSSIQMQLKQSTCEAVMILRSRFLDARRKRR
NFSKQATEILNEYFYSHLSNPYPSEEAKEELAKKCSITVSQVSNWFGNKRIRYKKNIGKF
QEEANLYAAKTAVTAAHAVAAAVQNNQTNSPTTPNSGSSGSFNLPNSGDMFMNMQSLNGD
SYQGSQVGANVQSQVDTLRHVINQTGGYSDGLGGNSLYSPHNLNANGGWQDATTPSSVTS
PTEGPGSVHSDTSN
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atggacgatcaatccaggatgctgcagactctggccggggtgaacctggccggccactcg
gtgcaggggggcatggccctgccgcctcccccgcacggccacgaaggggcggacggcgac
ggcaggaagcaggacatcggcgacatcctccaccagatcatgaccatcacggaccagagc
ttggacgaggcgcaagcaaagaaacatgccctgaactgtcacagaatgaaacccgcgctc
ttcagcgtcctgtgtgagatcaaagagaaaacaggtctcagcatcagaggagcccaggag
gaggaccctcccgatccccagctaatgagactggacaatatgcttttggcagaaggggtt
tcaggtcctgagaaaggtgggggatcggcggcagcagctgcagccgcggcagcctctgga
ggttcttcagataactctattgaacactcagattacagagccaaattgacccagatcaga
caaatctatcacacagaactggagaaatatgaacaggcatgtaatgaattcaccacacat
gtgatgaaccttctccgagaacagagtagaacacgtcccatttccccaaaagagattgaa
agaatggtgggcatcatccatcgaaaatttagttccattcagatgcagctcaaacaaagc
acttgtgaagcagttatgattttaagatcaaggttccttgatgccagacgaaaaaggcgt
aacttcagtaaacaggccacagaaatcttgaatgaatatttttactcacacctcagcaac
ccctaccccagtgaagaagccaaagaggagctggccaagaaatgcagcatcacagtgtca
caggtatccaactggtttggcaacaaacgaatcaggtacaagaaaaatatcggcaagttt
caggaagaagccaacctctacgctgcaaagacagctgtgacagccgcacacgcagtcgcc
gcagctgtgcagaacaaccagaccaattcgcccaccacgccaaattccggttcttctggt
tcttttaacctcccaaattctggggacatgttcatgaacatgcagagtctgaatggggat
tcttaccaagggtcccaagtcggagccaatgtgcaatcacaggtggataccctccgtcat
gttatcaatcagacgggaggctacagtgatggccttggaggaaattcactgtacagtcca
cataatttaaatgctaatggaggctggcaggacgcgacaactccatcttctgtgacttct
cctacagaaggcccaggaagtgtgcactctgatacctctaactaa

DBGET integrated database retrieval system