KEGG   Equus caballus (horse): 100070817Help
Entry
100070817         CDS       T01058                                 

Gene name
NDUFA6
Definition
(RefSeq) NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6
  KO
K03950  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 6
Organism
ecb  Equus caballus (horse)
Pathway
ecb00190  Oxidative phosphorylation
ecb01100  Metabolic pathways
ecb04714  Thermogenesis
ecb04723  Retrograde endocannabinoid signaling
ecb04932  Non-alcoholic fatty liver disease (NAFLD)
ecb05010  Alzheimer disease
ecb05012  Parkinson disease
ecb05016  Huntington disease
Module
ecb_M00146  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    100070817 (NDUFA6)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    100070817 (NDUFA6)
  09159 Environmental adaptation
   04714 Thermogenesis
    100070817 (NDUFA6)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100070817 (NDUFA6)
   05012 Parkinson disease
    100070817 (NDUFA6)
   05016 Huntington disease
    100070817 (NDUFA6)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100070817 (NDUFA6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Complex1_LYR Complex1_LYR_2 Flu_NP SpecificRecomb
Motif
Other DBs
NCBI-GeneID: 100070817
NCBI-ProteinID: XP_001500539
Ensembl: ENSECAG00000022520
VGNC: 20626
LinkDB All DBs
Position
28
AA seq 267 aa AA seqDB search
MRLSLSRSLGAAPASDRGSSATPCAPTGVPNERRSTARAGFPPSLQPVARAPPGGAVGPR
LGRPTAERAFPQMSMRRPHQPIFSRPQSLSSQSKGPRAAHPWGLGAGRLILANDRRYSFF
RHTRALKRGVGLGGDFLSKMAASGLSRAAAAAGTSVKPIFSRDMNEAKRRVRELYRAWYR
EVPNTVHLFQLDISVKQGRDKVREMFMKNAHVMDPRVVDLLVIKGKMELEETIKVWKQRT
HIMRFFHETEAPRPKDFLSKFYVGHDP
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgcgcctcagcctcagccgtagtcttggggccgcgccggcgagcgaccgaggaagctcc
gcgacgccctgcgcgcccacgggcgtcccaaacgagagacgctcgaccgcgcgcgccggc
ttcccgcccagcctccagcctgtggcgcgtgcgccccctggcggcgccgtcgggccacgt
ttaggacgaccaacggccgagcgggcgtttcctcaaatgagcatgcgcaggccccaccag
ccgatcttctcccgcccacagagcctttccagccaatcaaagggccccagagccgcccac
ccttggggcttgggggcggggcgtttaatcttagccaatgacagaagatattcgttcttc
cgccacactcgcgcgttgaaaaggggggtggggctaggaggcgatttccttagcaagatg
gcggcgagcggcctcagtcgggcagccgccgcggccggcacctcggtgaagcccattttc
agtcgggacatgaacgaggccaagcggagggtgcgcgagctctaccgcgcctggtaccgg
gaggtgccgaacactgtgcatttgttccagctagacatctctgtgaaacagggacgggat
aaagtccgagaaatgtttatgaagaatgcccatgtcatggaccccagggtagttgatctt
ctggtcattaagggaaagatggaactggaggaaacgattaaagtgtggaagcagcggaca
catattatgcggttcttccatgaaacagaagcgccaaggccaaaggacttcctgtccaag
ttttatgttggccatgacccgtga

DBGET integrated database retrieval system