KEGG   Equus caballus (horse): 100070861
Entry
100070861         CDS       T01058                                 

Gene name
STK4
Definition
(RefSeq) serine/threonine-protein kinase 4
  KO
K04411  serine/threonine kinase 4
Organism
ecb  Equus caballus (horse)
Pathway
ecb04010  MAPK signaling pathway
ecb04014  Ras signaling pathway
ecb04068  FoxO signaling pathway
ecb05200  Pathways in cancer
ecb05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100070861 (STK4)
   04014 Ras signaling pathway
    100070861 (STK4)
   04068 FoxO signaling pathway
    100070861 (STK4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100070861 (STK4)
  09162 Cancer: specific types
   05223 Non-small cell lung cancer
    100070861 (STK4)
Protein kinases [BR:ecb01001]
 Serine/threonine kinases: STE group
  STE20 family
   100070861 (STK4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Mst1_SARAH Pkinase_fungal Abi_2 Haspin_kinase DUF4611 Prothymosin
Other DBs
NCBI-GeneID: 100070861
NCBI-ProteinID: XP_001503215
Ensembl: ENSECAG00000021941
VGNC: 23695
UniProt: A0A3Q2HUZ0
LinkDB
Position
22
AA seq 487 aa
METVQLRNPPRRQLKKLDEDSLTKQPEEVFDVLEKLGEGSYGSVYKASHKETSQIVAIKQ
VPVESDLQEIIKEISIMQQCDSPHVVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKT
LTEDEIATILQSTLKGLEYLHFMRKIHRDIKAGNILLNTEGHAKLADFGVAGQLTDTMAK
RNTVIGTPFWMAPEVIQEIGYNCVADIWSLGITAIEMAEGKPPYADIHPMRAIFMIPTNP
PPTFRKPELWSDNFMDFVKQCLVKSPEQRATATQLLQHPFVKSAKGVSILRDLINEAMDV
KLKRQEAQQREVDQDDEENSEEDEMDSGTMVRAAGDEMGTVRVASTMSDGANTMIEHDDT
LPSQLGTMVINAEDEEEEGTMKRRDETMQPAKPSFLEYFEQKEKENQINSFGKSVPGPLK
NSSDWKVPQDGDYEFLKSWTVEDLQKRLLALDPMMEQEIEEIRQKYQSKRQPILDAIEAK
KRRQQNF
NT seq 1464 nt   +upstreamnt  +downstreamnt
atggagacggtgcagctgaggaacccgccgcgccggcagctgaaaaagttggatgaagat
agtttaactaaacaaccagaagaagtgtttgatgtcttagagaaacttggagaggggtcc
tatggcagcgtatacaaagctagtcataaagagaccagtcaaattgttgctattaagcaa
gttcctgtggaatcagacctgcaggagataatcaaagaaatctctataatgcagcagtgt
gacagccctcatgtagtgaaatattatggcagttattttaagaacacagacttgtggatt
gttatggagtactgtggggctggctctgtgtctgatatcattcgattacgaaataaaacg
ttaacagaagatgaaatagctacaatattacaatcaacacttaaaggactggaatacctt
cattttatgagaaaaatacaccgagatatcaaggcaggaaatattttgctaaacacagaa
ggacatgcaaaacttgcagattttggggtagcaggtcaacttacagataccatggccaag
cgaaatacagtgataggaacaccattttggatggctccagaagtgattcaggaaattggg
tacaactgtgtggcagacatctggtccttgggaataactgccatagaaatggctgaaggg
aaacccccgtatgcagatatccatccaatgagggcaatcttcatgattcctacaaaccct
cctcccacattccgaaagccagaactgtggtcagataacttcatggatttcgtgaagcag
tgtcttgtaaagagccctgagcagagagccacagccactcaactcctccagcacccattt
gtcaagagtgccaaaggagtgtcaatactgcgggacttaattaacgaagccatggatgtg
aaactgaaacgccaggaagcccagcagcgggaggtggaccaggacgatgaagaaaactca
gaggaggatgaaatggattctggcacgatggttcgagcagcaggtgatgagatgggcact
gtccgagtagccagcaccatgagtgatggggccaatactatgattgagcacgatgacacg
ttgccgtcacagctgggcaccatggtgatcaatgcggaggacgaggaagaggaagggact
atgaaaagaagagatgagaccatgcagcctgcaaaaccatcttttcttgaatactttgaa
caaaaggaaaaggaaaatcagatcaacagctttggcaagagcgttcctggcccgctgaag
aactcttctgattggaaagtaccacaggatggagactacgaatttctgaagagttggaca
gtggaggaccttcagaagaggctcttggccctcgaccccatgatggaacaggagattgaa
gagatccggcagaagtaccagtcgaagcggcagcccatcctggatgccatcgaggctaag
aagcggcggcaacaaaacttctga

DBGET integrated database retrieval system