KEGG   Equus caballus (horse): 100070973Help
Entry
100070973         CDS       T01058                                 

Gene name
GANC
Definition
(RefSeq) neutral alpha-glucosidase C isoform X2
  KO
K12317  neutral alpha-glucosidase C [EC:3.2.1.20]
Organism
ecb  Equus caballus (horse)
Pathway
ecb00052  Galactose metabolism
ecb00500  Starch and sucrose metabolism
ecb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    100070973 (GANC)
   00500 Starch and sucrose metabolism
    100070973 (GANC)
Enzymes [BR:ecb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     100070973 (GANC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 100070973
NCBI-ProteinID: XP_001500705
Ensembl: ENSECAG00000024930
VGNC: 18242
LinkDB All DBs
Position
1
AA seq 914 aa AA seqDB search
MDAAGREEISVEDEAVDKNIFKDCSNIAFYRRQKQQLSRKSMYRALLDSVTADRDSTRFQ
IINEATKAPLLAEVYGIEGNIFRLKINEETPLKPRYEVPDVLTSKLSTVRLTSCSGDSGS
LVLADGKGDLKCHITANPFKVDLVSEEEVVMSINSLGQLYFEHLQIPLKQRATKENEEDA
SVDTSQENQEDLGLWEEKFGKFVDVKVNGPASIGLDFSLHGFEHLYGIPQHAESHQLKNT
GDGDAYRLYNLDVYGYKIHDKMGIYGSVPYLLAHKLGRTLGIFWLNASETLVEINTEPEV
KYTLTQTGPAAAKQKVTSRTDVHWMSESGIIDVFLLTGPTPSDVFKQYSRLTGTQALPPL
FSLGYHQCRWNYEDEQDVKAVDAGFDEHDIPYDVMWLDIEHTEGKRYFTWDKKRFPNPKR
MQELLRSKKRKLVVISDPHIKVDLDYSVYAKAKELGFFVRNHEGGDFEGVCWPGLSSYLD
FTNPKVREWYSGLFAFSAYQGSTDILYIWNDMNEPSVFRGPELTMQKNAIHHGNWEHREL
HNIYGFYHQMATAEGLIQRSKGKERPFVLTRSFFAGSQKYGAVWTGDNTAEWSYLKISIP
MLLTLSVTGISFCGADVGGFIGNPDAELLVRWYQAGAYQPFFRGHATMDTKRREPWLFGE
EHTRLIREAIRQRYTLLPYWYSLFYRAHVASEPVMRPLWIEFPDALEAFGVEDEYMLGSA
LLVHPVTELEATVVDVFLPGSNEVWYDSKTFTRWEGACTVKIPVDLDTIPVFQRGGSVVP
IKTTIGKSTGCMTDSPYGLRVALSTKGSAVGEFYLDDGHSFQYVHQKQFLHRKFSFCSGV
LINSCADERGRYPSKCVVEQIFILGLKKKPSSVTTHSSGGEDQPVAFVYCAKTSTLSLEK
LSLDIGTDWEVHVK
NT seq 2745 nt NT seq  +upstreamnt  +downstreamnt
atggacgctgccgggagagaggaaatcagtgttgaagatgaagctgtggataaaaacatt
ttcaaagactgcagcaacattgctttctacaggcgtcagaaacagcagctctccaggaag
tccatgtatcgggcattactggactcggtcacagcggacagagacagcactagattccaa
atcatcaatgaagcgacgaaggctcctctcttggctgaagtttatggtatagagggaaat
atcttcaggcttaaaatcaatgaagaaactcccctgaaacccagatatgaagttcctgat
gtcctcacaagcaagctaagcactgtaaggctgacttcatgctcaggggactcaggcagt
ctggtgttggcagatggcaaaggagatctgaagtgtcatattacggcaaacccattcaag
gtagacttggtgtctgaagaggaggtcgtgatgagcataaactccttgggccaattgtac
tttgaacacctgcaaattcctctcaagcaaagagctaccaaagaaaatgaggaggatgca
tcagttgacacctctcaggaaaatcaagaggatctgggcctgtgggaggagaaattcgga
aaatttgtggatgtcaaagttaatggtcctgcctccattggtttggatttctccttgcat
ggatttgagcatctctatgggatcccgcaacatgcagaatcacaccaacttaaaaatact
ggtgatggggatgcttaccgtctttataacctggatgtctatggatataaaatacatgac
aaaatgggcatttatggttcagtgccttatctcctggcccacaaactgggcaggactcta
ggcattttttggctgaatgcctcagaaacactagtggagatcaatacagagcctgaagta
aagtacacactgacccagacgggcccagctgctgccaaacaaaaggtcacatctcggacc
gatgtgcactggatgtcagagagtggaatcattgatgtttttctgctgacaggacctaca
ccatctgacgtcttcaagcagtactcgcgccttacaggcacacaagccttgccccctctc
ttctccttggggtaccatcagtgccgctggaactatgaagatgagcaagatgtaaaagca
gttgatgcagggtttgatgaacatgacattccttatgacgtcatgtggctggacatagag
cacactgagggcaaaaggtacttcacttgggacaagaaaagattcccaaaccccaaaagg
atgcaagagctgctcaggagcaaaaaacgtaagcttgtggtcatcagtgacccccacatc
aaggttgatcttgactactcagtgtatgccaaagctaaagaactgggcttcttcgtgagg
aatcatgaagggggagactttgaaggggtgtgctggcctggtctctcctcttacctggat
ttcaccaatcccaaagtcagagagtggtattcaggtctttttgctttctctgcttatcag
ggatctactgacatcctctacatatggaatgacatgaatgaaccctctgtctttagaggg
ccagagctaactatgcagaagaatgctattcatcatggcaactgggagcacagagaacta
cacaacatctatggtttttatcatcaaatggctactgcagaaggactaatacaacgatca
aaagggaaggagagaccctttgttcttacacgttctttctttgctggatcacaaaagtat
ggtgctgtgtggacaggcgacaacacagcagaatggagttacctgaaaatttctatccct
atgttgctcactctcagtgtcactgggatctctttttgtggagctgatgtaggcggcttc
atcgggaacccagacgcagagctgctagtgcgttggtaccaggccggagcctaccagccc
ttcttccgtggccacgccactatggacaccaagcgacgggaaccgtggctcttcggagag
gaacacacccggctcatccgagaagccatcagacagcgctacaccctcctaccctattgg
tattctctgttctaccgtgcacacgttgcttctgaacccgtcatgaggcctctgtggata
gagttccctgatgcattagaggcttttggtgtggaagatgagtacatgctaggaagtgct
ttgttggttcatccagtcacagaactggaagccactgtagttgatgtgtttctgccagga
tcaaatgaggtctggtatgactctaagacatttactcgttgggaaggagcatgtactgtg
aagatcccagtagacttggacactataccagtgtttcaacgaggtggaagtgtagtgcca
ataaagacaactataggaaagtccacaggctgcatgactgattccccatatggactccgg
gtggctctaagcactaagggttctgccgtgggtgaattctatcttgatgatggccattca
ttccaatacgtccaccagaagcaattcttgcacaggaagttttcattctgttcaggtgtt
ttgatcaacagttgtgccgatgagagaggtcgttatcccagcaagtgtgtggtggagcag
atctttatcctaggcctcaagaagaagccatcttctgtgaccacccactcatctggtggt
gaagaccagcctgtggcttttgtatattgtgccaaaacatccaccttgagcctggagaag
ctctcactggacattggtactgactgggaggtccacgtcaaatga

DBGET integrated database retrieval system