KEGG   Equus caballus (horse): 100072219
Entry
100072219         CDS       T01058                                 

Gene name
CCNA2
Definition
(RefSeq) cyclin-A2
  KO
K06627  cyclin-A
Organism
ecb  Equus caballus (horse)
Pathway
ecb04110  Cell cycle
ecb04152  AMPK signaling pathway
ecb04218  Cellular senescence
ecb04914  Progesterone-mediated oocyte maturation
ecb05161  Hepatitis B
ecb05165  Human papillomavirus infection
ecb05166  Human T-cell leukemia virus 1 infection
ecb05169  Epstein-Barr virus infection
ecb05200  Pathways in cancer
ecb05202  Transcriptional misregulation in cancer
ecb05203  Viral carcinogenesis
ecb05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    100072219 (CCNA2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100072219 (CCNA2)
   04218 Cellular senescence
    100072219 (CCNA2)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100072219 (CCNA2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100072219 (CCNA2)
   05202 Transcriptional misregulation in cancer
    100072219 (CCNA2)
   05203 Viral carcinogenesis
    100072219 (CCNA2)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    100072219 (CCNA2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100072219 (CCNA2)
   05161 Hepatitis B
    100072219 (CCNA2)
   05169 Epstein-Barr virus infection
    100072219 (CCNA2)
   05165 Human papillomavirus infection
    100072219 (CCNA2)
DNA replication proteins [BR:ecb03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    100072219 (CCNA2)
Chromosome and associated proteins [BR:ecb03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    100072219 (CCNA2)
SSDB
Motif
Pfam: Cyclin_N2 Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 100072219
NCBI-ProteinID: XP_023492387
Ensembl: ENSECAG00000024357
VGNC: 16203
LinkDB
Position
2
AA seq 432 aa
MLGSSAPGPAAREAGSALLTLQQTALQEDQENINPEKAGPAQQPRTRAGLAVLKAGHPRG
PAPQQRPKTRRVAPLKDLPINDEHVTVPPWKANSKQPAFTIHVDEAEEEPQKRPGESKKT
ECEDALALNSAITLPGPRKPLAPLDYPMDGSFESPHNMDMSIVSEDEKPVSVNEVPDYHE
DIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYID
RFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLK
VLAFDLAAPTVNQFLTQYFLHQQSANSKVESLAMFLGELSLIDADSYLKYLPSVIAGAAF
HLALYTVTGQSWPESLAQKTGYTLQSLKPCLLDLHQTYLRAPHHAQQSIREKYKSSKYHG
VSLLNPPDTLNV
NT seq 1299 nt   +upstreamnt  +downstreamnt
atgctgggcagctccgcgcccgggcctgcggcccgcgaggcgggttcggcgctgctaaca
ttgcagcaaacggcgctccaggaggaccaggagaacatcaaccccgagaaggcggggccc
gcccagcagccccggacccgggccgggctggcggtactaaaggccgggcaccctcgcggt
ccagctccgcagcagaggcccaaaacgcgacgggttgctccacttaaagatcttcctata
aatgatgagcatgtcactgttcctccctggaaagcaaacagtaaacagcctgcatttacc
attcatgtggatgaagcagaagaggagccacagaagaggccaggtgaatctaaaaaaaca
gaatgcgaagatgccctggctttgaattcagctattactttgcctggaccaagaaaacca
ctggcacctcttgattatccaatggatggtagttttgagtcaccacataatatggacatg
tcaattgtatcggaagatgaaaagccagtaagtgttaatgaagtaccagactaccatgag
gatattcacacataccttagggaaatggaggttaaatgtaagcctaaagtgggttacatg
aagaaacagccagacatcactaacagtatgagggctatccttgtggactggttagttgaa
gtaggagaagaatataaactacaaaatgagaccctgcatttagctgtgaactacattgat
aggttcctttcatcgatgtccgtgttgagaggaaaacttcagcttgtgggcactgctgct
atgctgttagcctcaaagtttgaagaaatataccccccagaagtagcagagtttgtgtac
attacagatgatacctataccaagaaacaagttctgagaatggagcacttagttttgaaa
gtccttgcttttgacttagccgcaccgacagtcaatcagtttcttacccaatactttctg
caccagcagtctgcaaacagcaaagttgaaagtttagcaatgtttttgggagagctgagt
ttgatagatgctgactcatacctaaagtatttgccgtcagttattgctggagcggccttt
catttagcactctacacggtcacaggacaaagctggcctgaatccttagcacagaagact
gggtacaccctgcaaagtctcaagccttgtctcctggaccttcaccagacctacctcaga
gcgccacaccacgcacaacagtcaataagagaaaagtacaaaagttcaaagtatcatggt
gtttctctcctcaacccaccagatacactaaacgtgtaa

KEGG   Equus caballus (horse): 100147188
Entry
100147188         CDS       T01058                                 

Gene name
CCNA1
Definition
(RefSeq) cyclin-A1
  KO
K06627  cyclin-A
Organism
ecb  Equus caballus (horse)
Pathway
ecb04110  Cell cycle
ecb04152  AMPK signaling pathway
ecb04218  Cellular senescence
ecb04914  Progesterone-mediated oocyte maturation
ecb05161  Hepatitis B
ecb05165  Human papillomavirus infection
ecb05166  Human T-cell leukemia virus 1 infection
ecb05169  Epstein-Barr virus infection
ecb05200  Pathways in cancer
ecb05202  Transcriptional misregulation in cancer
ecb05203  Viral carcinogenesis
ecb05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    100147188 (CCNA1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100147188 (CCNA1)
   04218 Cellular senescence
    100147188 (CCNA1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100147188 (CCNA1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100147188 (CCNA1)
   05202 Transcriptional misregulation in cancer
    100147188 (CCNA1)
   05203 Viral carcinogenesis
    100147188 (CCNA1)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    100147188 (CCNA1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100147188 (CCNA1)
   05161 Hepatitis B
    100147188 (CCNA1)
   05169 Epstein-Barr virus infection
    100147188 (CCNA1)
   05165 Human papillomavirus infection
    100147188 (CCNA1)
DNA replication proteins [BR:ecb03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    100147188 (CCNA1)
Chromosome and associated proteins [BR:ecb03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    100147188 (CCNA1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C Cyclin_N2
Other DBs
NCBI-GeneID: 100147188
NCBI-ProteinID: XP_005601203
Ensembl: ENSECAG00000019420
VGNC: 16202
LinkDB
Position
17
AA seq 421 aa
MHCSSSKSGVVLAPVSRGPDACQMITRAHLGQDPPQRTVLGVLTENGQYRRTCGQGITTL
RCFSGSENVFPSTGKKLLSDCGVHVPAKQGFDIYMDEPEQGDRDSCTEREGMAFEDAYEV
DTSTLKSDLHFLLDFSTVSPMLVDSSLHSQSEDASDFGTDVINVTEYAEEIHQYLREAEI
RYRPKAHYMRKQPDITEGMRTILVDWLVEVGEEYKLRAETLYLAVNFLDRFLSCMSVLRG
KLQLVGTAAILLASKYEEIYPPEVDEFVYITDDTYTKRQLLRMEHLLLKVLAFDLTVPTT
NQFLLQYLRRQGVCVRTENLAKYVAELSLLEADPFLKYLPSLIAAAAYCLANYTVNRHFW
PETLAAFTGYSLSEIVPCLSELHKACLDITHRPQQAIREKYKASKYMHVSLLEPPAVLPL
Q
NT seq 1266 nt   +upstreamnt  +downstreamnt
atgcattgcagcagctccaagagcggggtggtcttggctccagtgtcccgaggtcctgat
gcctgtcagatgataaccagagcccacctcggccaggatcccccccaaagaacagtgcta
ggggtgctgactgagaatgggcagtacaggaggacctgtggccaggggatcacaacactc
agatgtttctctggatcagaaaatgtcttcccttcaactggaaagaaactgctctctgac
tgtggggtccatgtgcccgccaagcaaggatttgatatctacatggatgagcctgagcag
ggtgacagagacagctgtacagaaagagaggggatggcatttgaggatgcgtatgaagta
gacaccagcacactcaagtcagaccttcacttcttgctggattttagcacagtttccccc
atgctggtagattcatctctccattcccagtctgaagatgcatcagattttggtacagat
gtgataaatgtgactgaatatgctgaagaaattcatcagtaccttagagaagctgaaata
agatacaggcccaaagcgcactacatgaggaaacagccggacatcacggaaggcatgcgc
acaattctggtggactggctggtggaggtcggagaagaatataagcttcgagcagagact
ctctacctggctgtcaacttcctggacaggtttctctcctgcatgtctgttctgagaggg
aaactgcagcttgtgggaacagcagctattcttctggcttcgaaatatgaagaaatatat
ccccccgaagtagacgagtttgtctacataactgatgatacttacacaaagcggcagctg
ttaagaatggaacacctgctcctgaaagtcctggcttttgatttgacggtgccaacgacc
aaccagtttctccttcagtacttgaggaggcaaggagtgtgtgtcagaaccgagaacctg
gccaagtacgtagcggaactgagtctacttgaagctgacccattcttgaaatatcttcct
tcactgatagctgcagcagcttattgcctggcaaactatactgtgaacaggcacttctgg
ccagaaacccttgctgcctttacaggctattcattaagtgaaatcgttccttgcctgagt
gagctacacaaagcgtgccttgacataacccatcgacctcagcaagcaattcgggagaag
tataaggcttcgaagtacatgcacgtgtctctcctggaaccccctgcagtgcttcctcta
cagtaa

DBGET integrated database retrieval system