KEGG   Equus caballus (horse): 100072574
Entry
100072574         CDS       T01058                                 

Gene name
EGR1
Definition
(RefSeq) early growth response protein 1
  KO
K09203  early growth response protein 1
Organism
ecb  Equus caballus (horse)
Pathway
ecb04371  Apelin signaling pathway
ecb04912  GnRH signaling pathway
ecb04928  Parathyroid hormone synthesis, secretion and action
ecb04933  AGE-RAGE signaling pathway in diabetic complications
ecb05020  Prion disease
ecb05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100072574 (EGR1)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    100072574 (EGR1)
   04928 Parathyroid hormone synthesis, secretion and action
    100072574 (EGR1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05020 Prion disease
    100072574 (EGR1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100072574 (EGR1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100072574 (EGR1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ecb03000]
    100072574 (EGR1)
Transcription factors [BR:ecb03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 SP/KLF family and related proteins
    100072574 (EGR1)
SSDB
Motif
Pfam: DUF3432 DUF3446 zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2HC_2 Zf_RING zf-BED zf-C2H2_8 zf-H2C2_5
Other DBs
NCBI-GeneID: 100072574
NCBI-ProteinID: XP_001502603
Ensembl: ENSECAG00000014338
VGNC: 17462
LinkDB
Position
14
AA seq 542 aa
MAAAKAEMQLMSPLQISDPFGSFPHSPTMDNYPKLEEMMLLSNGAPQFLGAAGAPEGSGG
NSSSSSGGGGAGGGSSNSSSSSAFNPQGEAGEQPYEHLTSESFPDISLNNEKVLVETSYP
SQTTRLPPITYTGRFSLEPAPNSGNTLWPEPLFSLVSGLVSMTNPPATSSSAPSPAASSS
SSASQSPPLSCAVQSNDSSPIYSAAPTFPTPNTDIFPEPQNQAFPGSAGTALQYPPPAYP
AAKGGFQVPMIPDYLFPQQQGDLGLGTPDQKPFQGLESRTQQPSLTPLSTIKAFATQSGS
QDLKALNTTYQSQLIKPSRMRKYPNRPSKTPPHERPYACPVESCDRRFSRSDELTRHIRI
HTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLRQ
KDKKADKGVVASSATSSLSSYPSPVATSYTSPVTTSYPSPATTSYPSPVPTSFSSPGSST
YPSPVHSGFPSPSVATTYSSVPPAFPAQISSFPSSAVTNSFSASTGLSDMTTTFSPRTIE
IC
NT seq 1629 nt   +upstreamnt  +downstreamnt
atggccgcagccaaggccgagatgcagctgatgtccccgctgcagatctccgatccgttt
ggctcctttcctcactcgcccaccatggacaactaccctaagctggaggagatgatgctg
ctgagcaacggggctccccagttcctcggtgccgccggagcccctgagggcagcggcggt
aacagcagcagcagcagcgggggcggtggagctggagggggcagcagcaacagcagcagc
agcagcgccttcaaccctcagggggaggcaggcgagcagccctacgagcacctgacctca
gagtcttttcctgacatctctctgaataacgagaaggttctcgtggagacaagttacccg
agccaaaccacccggctgccccccatcacctacactggccgtttttctctggagcctgcg
cccaacagtggcaacaccttgtggcctgagcccctcttcagcctggtcagtggcctcgtg
agcatgaccaacccaccggccacttcatcttcagcaccatctccggcggcctcctcttcc
tcttctgcctcccagagcccacctctgagctgtgcggtgcagtccaacgacagcagcccc
atttactccgcggcacccaccttccccacgcctaacactgacatcttccctgagccacaa
aaccaggcctttcccggctcggcaggcaccgcgctccagtacccacctcctgcttaccct
gctgccaagggtggcttccaggtccccatgatccctgactacctgtttccacagcagcag
ggggacttgggcctgggcacgccagaccaaaagcccttccagggcctggagagccgtacc
cagcagccttcactcactccactctctaccatcaaggcctttgccacacagtcgggctcc
caggacctgaaggccctcaacaccacctaccagtctcagctcatcaaacccagccgcatg
cgcaagtaccccaaccggcccagcaagacgcccccccacgaacgcccctatgcctgccca
gtggagtcctgtgaccgccgcttctcccgctcagatgagcttacccgccacattcgcatc
cacactggccagaagcccttccagtgtcgcatctgcatgcgcaacttcagccgcagtgac
cacctcaccacccacatccgcacccacacaggcgagaagcccttcgcctgcgacatctgt
gggagaaagtttgccaggagcgatgaacgcaagaggcataccaagatccacctgcggcag
aaggacaaaaaagcagacaaaggtgttgtggcctcttctgccacctcctccctctcttcc
tacccgtccccggtggctacctcctacacgtccccggttactacctcttatccatcccca
gccaccacctcatacccatcgcctgtgcccacctccttctcctctcccggctcctcgacc
tacccgtcccctgtgcacagtggcttcccctcaccctcggtggccaccacatactcctcc
gttccccctgctttcccagcccaaatcagtagcttcccttcttcagctgtcaccaactcc
ttcagcgcctccacagggctttcggacatgacaacaaccttttctccgaggacaattgaa
atttgctaa

DBGET integrated database retrieval system