KEGG   Equus caballus (horse): 100072687Help
Entry
100072687         CDS       T01058                                 

Gene name
HK1
Definition
(RefSeq) hexokinase-1 isoform X2
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
ecb  Equus caballus (horse)
Pathway
ecb00010  Glycolysis / Gluconeogenesis
ecb00051  Fructose and mannose metabolism
ecb00052  Galactose metabolism
ecb00500  Starch and sucrose metabolism
ecb00520  Amino sugar and nucleotide sugar metabolism
ecb00524  Neomycin, kanamycin and gentamicin biosynthesis
ecb01100  Metabolic pathways
ecb01200  Carbon metabolism
ecb04066  HIF-1 signaling pathway
ecb04910  Insulin signaling pathway
ecb04930  Type II diabetes mellitus
ecb04973  Carbohydrate digestion and absorption
ecb05230  Central carbon metabolism in cancer
Module
ecb_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ecb_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100072687 (HK1)
   00051 Fructose and mannose metabolism
    100072687 (HK1)
   00052 Galactose metabolism
    100072687 (HK1)
   00500 Starch and sucrose metabolism
    100072687 (HK1)
   00520 Amino sugar and nucleotide sugar metabolism
    100072687 (HK1)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    100072687 (HK1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    100072687 (HK1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100072687 (HK1)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100072687 (HK1)
 09160 Human Diseases
  09161 Cancers
   05230 Central carbon metabolism in cancer
    100072687 (HK1)
  09166 Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    100072687 (HK1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ecb04131]
    100072687 (HK1)
Enzymes [BR:ecb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     100072687 (HK1)
Membrane trafficking [BR:ecb04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    100072687 (HK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 CSD UvrD-helicase
Motif
Other DBs
NCBI-GeneID: 100072687
NCBI-ProteinID: XP_014588673
Ensembl: ENSECAG00000010479
VGNC: 18796
UniProt: F7BA85
LinkDB All DBs
Position
1
AA seq 915 aa AA seqDB search
MIAAQLLAYYFTELKDDQIKKIDKYLYTMRLSDETLMDIMTRFKKEMKNGLSRDFNPTAT
VKMLPTFVRSIPDGSEKGDFIALDLGGSSFRILRVQVNHEQNQNVHMESEIYDTPENIVH
GSGSQLFDHVAECLGDFMEKRKIKDKKLPVGFTFSFPCRQSKIDEAILITWTKRFKASGV
EGADVVKLLEKAIKKRGDYDANIVAVVNDTVGTMMTCGYDDQHCEVGLIIGTGTNACYME
ELRHIDLVEGDEGRMCINTEWGAFGDDGSLEDIRTEFDREIDRGSLNPGKQLFEKMVSGM
YMGELVRLILVKMAKEGLLFEGRITPELLTRGKFNTSDVTAIEKNKEGLHNAKEILTRLG
VEPSDDDCIAVQHVCTIVSFRSANLVAATLGAILTRLRDNKGSPRLRTTVGVDGSLYKTH
PQYSRRFHKTLRRLVPDSDVRFLLSESGSGKGAAMVTAVAYRLAEQHRQIKETLAHFSLT
KDMLLEVKRRMRAEMEMGLRKQTNDRAVVKMLPSFVRSTPDGTEHGDFLALDLGGTNFRV
LLVKIRSGKKRTVEMHNKIYAIPVEIMQGTGEELFDHIVSCISDFLDYMGIKGPRMPLGF
TFSFPCKQTSLDAGILVTWTKGFKATDCVGHDVATLLRDAVKRREEFDLDVVAVVNDTVG
TMMTCAYEEPTCEVGLIVGTGSNACYMEEMKNVEMVEGSEGRMCINMEWGAFGDNGCLDD
IRTHYDRLVDEYSLNPGKQRFEKMISGMYLGEIVRNILIDFTKKGFLFRGQISETLKTRG
IFQTKYLSQIESDRLALLQVRAILQQLGLNSTCDDSILVKTVCGVVSKRAAQLCGAGMAA
VVDKIRENRGLDHLNVTVGVDGTLYKLHPHFSRIMHQTVKELSPQCNVSFLLSEDGSGKG
AALITAVGVRLREDS
NT seq 2748 nt NT seq  +upstreamnt  +downstreamnt
atgatcgccgcgcagctcctggcgtactacttcaccgagctgaaggatgatcaaatcaaa
aagattgacaagtatctctataccatgcggctctctgatgaaactctgatggatatcatg
actcgtttcaagaaggaaatgaagaatggcctctctcgggattttaatccgacagccaca
gtcaagatgttgccaacatttgtaaggtctattcctgatggttcagaaaagggagatttc
attgccctggatcttggtgggtcttcctttcgaattctgcgggttcaagtgaatcatgag
caaaaccagaatgtccacatggagtccgagatttatgacaccccggagaacatcgtgcac
ggcagtggaagccagctttttgatcatgtcgccgagtgcctgggagacttcatggagaaa
agaaaaatcaaggataagaaattacccgtgggattcacattttctttcccttgtcggcaa
tccaaaatagacgaggccatcctgatcacctggacaaagaggtttaaagcgagcggagtg
gagggagcggatgtggtgaagctgcttgaaaaagccatcaaaaagcgtggggattatgat
gccaacattgtggctgtggtgaatgacacggtggggaccatgatgacctgtggctatgat
gaccagcactgtgaagttgggctcatcattggcactggcaccaatgcttgctacatggag
gaactgaggcacattgacctggtggaaggtgacgagggcaggatgtgcatcaacacggag
tggggggcctttggggacgacgggtccctagaagacatccgcactgagttcgaccgggag
atagaccggggctccctcaaccccggcaaacagctgtttgagaagatggtcagtggcatg
tacatgggggagctggttcgactgatcctggtcaagatggccaaggaaggcctcttattt
gaagggcggatcactccagagctgctcaccagagggaagtttaacaccagtgatgtgaca
gccattgaaaagaataaggaaggcctccacaatgccaaagaaatcctgacccgcctggga
gtggagccgtctgatgacgactgtattgcagtccagcacgtgtgtaccattgtctcattt
cgctctgccaacctggtggctgcaacgctgggcgccatcttgactcgccttcgagataac
aagggctcacccaggctgcggaccacggttggtgtcgacgggtctctttacaagacgcac
ccacagtattcccggcgtttccacaagactctgaggcgcttggtgcccgactccgatgta
cgtttcctcctctcggagagtggcagcggcaagggggccgccatggtgaccgcagtggcc
tatcgcctggctgagcagcaccgccagataaaggagaccctggcccacttcagcctcacc
aaggatatgctgctggaggtgaagcggaggatgcgggctgagatggagatggggctgagg
aagcaaacgaacgaccgggctgtggtcaagatgctgccctccttcgtccgcagcactcca
gatgggaccgagcatggtgacttcttggccctggatcttggaggaacgaatttccgtgtc
ctactggtgaaaatccgtagtgggaaaaagagaacggtggaaatgcacaacaagatctat
gccattcctgttgaaatcatgcagggcactggggaagagctgtttgaccacatagtctcc
tgcatctctgacttcctggactacatggggatcaaaggtcccagaatgcccctgggcttc
acgttctcattcccctgcaagcagacgagcttggacgcgggaattttggtcacctggacg
aagggttttaaggcaaccgactgcgtggggcatgatgtagcgaccttactaagggatgcg
gtcaaaaggagagaggaatttgacctggacgtggtggctgtggtcaacgacacggtgggc
accatgatgacctgtgcttatgaagagcccacctgtgaggttggactcatcgtagggact
ggcagcaatgcctgctacatggaagaaatgaagaacgtcgaaatggtggaaggaagtgag
gggcggatgtgtatcaacatggagtggggtgcctttggggacaacggctgtctggacgat
atcagaacacactatgacagactggtggatgaatattctctaaaccctgggaaacaaagg
tttgagaagatgatcagtgggatgtacctgggtgagattgtccgaaacatcctgatcgac
ttcaccaagaagggattcctcttccgagggcagatctctgagacgctgaagacgcggggc
atctttcagaccaagtatctctctcagattgagagtgaccgattagcactgctccaggtc
cgggccattctccagcagctgggcctgaacagcacctgcgacgacagtatccttgtcaag
accgtgtgtggggtggtgtccaagagggccgcgcagctgtgtggcgcgggcatggctgcc
gtggtggataagatccgtgagaacagagggctggaccatctcaacgtgactgtcggggtg
gatggaacgctctacaagcttcatccgcacttctccagaatcatgcaccaaaccgtgaag
gaactgtcaccacagtgtaacgtgtctttcctcctgtccgaagacggtagtggcaagggg
gccgccctcatcacagcagtgggcgtacggctccgagaagacagctaa

DBGET integrated database retrieval system