KEGG   Equus caballus (horse): 100072821Help
Entry
100072821         CDS       T01058                                 

Gene name
ENPEP
Definition
(RefSeq) glutamyl aminopeptidase
  KO
K11141  glutamyl aminopeptidase [EC:3.4.11.7]
Organism
ecb  Equus caballus (horse)
Pathway
ecb04614  Renin-angiotensin system
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09150 Organismal Systems
  09152 Endocrine system
   04614 Renin-angiotensin system
    100072821 (ENPEP)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ecb01002]
    100072821 (ENPEP)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ecb04147]
    100072821 (ENPEP)
   04090 CD molecules [BR:ecb04090]
    100072821 (ENPEP)
Enzymes [BR:ecb01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.7  glutamyl aminopeptidase
     100072821 (ENPEP)
Peptidases and inhibitors [BR:ecb01002]
 Metallo peptidases
  Family M1
   100072821 (ENPEP)
Exosome [BR:ecb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100072821 (ENPEP)
CD molecules [BR:ecb04090]
 Proteins
  100072821 (ENPEP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N DUF1570
Motif
Other DBs
NCBI-GeneID: 100072821
NCBI-ProteinID: XP_001502921
Ensembl: ENSECAG00000009107
VGNC: 17590
LinkDB All DBs
Position
2
AA seq 948 aa AA seqDB search
MNFAEKEDSKRYCIKAKHVAIICAVVVGVGLIVGLAVGLTRSCDSAGDAGQSTPPAPSSS
SPPQDQGVCPASEDESGEWTNFRLPDFINPVHYDLEMKPLMEEDRYTGSVTISINVSSPT
RYLWLHLRETRITQLPVLRRPSGEQVQVRRCFQYTQQEYVVVEAGEELAPSSGESLYALT
MDFAGWLNGSLVGFYKTTYVEGGQVKSIAAADHEPTDARKSFPCFDEPNKKATYTISIIH
PKEYEALSNMPVEKQESLDNEWTRTTFQKSVPMSTYLVCFAVHQFASVQRTSNRGIPLTI
YVQPEQKHTAEYAANITKTVFDYFEEYFGMNYSLPKLDQIAIPDFGTGAMENWGLITYRE
TNLLYDPEESASSNQQRVASVVSHELVHQWFGNIVTMDWWEDLWLNEGFASFFEFLGVNH
AEGEWQMLDQILLEDVLPVQEDDSLMSSHPIVVTVATPAEITSVFDGISYSKGASILRML
EDWITPEKFQRGCQIYLEKYQFKNAKTSDFWEALEEASNLPVKEVMDTWTRQMGYPVLNV
NDRTNLSQNRFLLDPTANSSQPHSVLGYTWNIPVRWTEDNVSSITIYNRSETGGITLDSS
NPSGNGFLKINPDHIGFYRVNYEVPTWDWIATNLSLNHEGFSSADRASFIDDAFALARAQ
LLDYKVALNLTRYLKMEQDYLPWQRVISAITYIISMFEDDNEVYPLIEDYFQGQVKPLAD
SLGWTDTGDHVTKLLRASVLGLACRMQDREALGNASQLFQEWLSGTARLPVNLRLLVYRY
GMQTSGNETSWNYTLDQYQETSLAQEKEKLLYGLASVRNVTLLSRYLDLLKDSSVIKTQD
VFTVIRYISYNSYGKSMAWNWVQLNWDYLVNRYTINDRYLGRIVTIAEPFNTELQLWQME
SFFKKYPEAGAGEQPREQVLETVRNNIEWLKQNRDAIKQWFLDLSRNG
NT seq 2847 nt NT seq  +upstreamnt  +downstreamnt
atgaactttgcggagaaagaggactctaagagatactgcatcaaagcgaaacatgtggcc
attatctgtgcggtggtggtgggcgtaggactaatagtgggactggctgtgggcttgacc
aggtcgtgtgactccgcgggagacgctgggcagagcacgcctccggctccttcctcttcg
agccctccgcaggaccagggagtctgccctgccagtgaggatgaaagtggagagtggaca
aatttcaggctgccggacttcatcaacccggtgcactacgacctggagatgaagcccctg
atggaagaggacaggtacacgggcagcgtgaccatctccatcaacgtcagctcgcccacc
cggtacctgtggctgcacctgcgggagaccaggatcacccagctcccggtgctgcggagg
ccctccggggagcaggtgcaagtcaggcggtgcttccagtacacacagcaggagtatgtg
gtggtcgaggcgggagaagagcttgcgcccagcagtggggagagtctctatgccctgact
atggacttcgccggctggctgaacggctcgctcgtggggttttataaaacgacctacgtg
gagggaggacaagtcaagagcatagcagccgctgatcatgaaccaacagacgccaggaaa
tccttcccttgtttcgatgagcccaacaaaaaggcaacttatacaatatctatcatccat
cccaaagaatatgaggcactttcaaatatgccagtggagaaacaagagtcgctggataat
gaatggactcgaacaactttccagaagtctgtccccatgagcacatacctggtgtgcttt
gctgtgcaccagtttgcatccgtacagagaacgtcgaatcggggaatacctctcactata
tatgtccagccagagcaaaagcacacagctgaatatgctgcaaacataactaaaactgtg
tttgattattttgaagaatactttggtatgaattattctcttcctaaattagatcaaata
gctattccagattttggcactggcgccatggagaactgggggctcatcacttacagggaa
acgaacctgctttatgaccctgaggaatcagcctcgtcaaaccaacagagggtggccagt
gtggttagccatgaacttgtgcatcagtggtttggaaatattgtgaccatggactggtgg
gaagacctgtggctcaatgaggggtttgcatccttctttgagttcctgggagtgaaccac
gcagaaggagagtggcagatgcttgaccagatcctacttgaagatgtcttacctgttcaa
gaggatgattctttgatgtcttcacacccaattgttgtcactgtggcaactcctgctgaa
ataacatctgtttttgatggaatctcctatagcaagggagcttccattctgagaatgctt
gaagactggataacaccagagaaattccaaagaggatgtcagatttacttggaaaaatat
caatttaagaatgcaaaaacttcagatttttgggaagcacttgaagaggcaagcaatctg
cccgttaaagaagtaatggacacctggacgagacagatgggctatccggtgctcaatgtg
aatgacagaacaaacctctcacagaatcgctttctgttggacccaacagccaattcttcc
cagccacattctgtgcttggttacacatggaatattccagttagatggactgaagataat
gtttcaagtattacaatctacaataggtcagaaacaggaggaatcactttggattcttct
aatcctagtggaaatggctttctcaaaataaacccagatcatattgggttttatcgtgta
aattatgaagtaccaacttgggactggatagctaccaatctttccctcaaccacgagggc
ttttcttctgctgatcgtgcaagttttattgatgatgcttttgctttggcaagagctcaa
cttctagactataaagtggctctgaacttgaccagatatctcaaaatggaacaggactat
ttaccatggcagagagtcatttcagctataacctatatcatcagcatgtttgaagatgat
aacgaagtataccctttgattgaggactacttccaaggtcaagtgaagccccttgccgat
tctctgggatggactgacactggagaccacgtcacaaagttgctccgtgcctctgtgcta
gggctcgcgtgcaggatgcaagatagagaagccttgggcaatgcttcccagttatttcag
gagtggctgagcgggactgcaaggcttcctgtaaatctcaggcttctggtatatcggtac
ggaatgcagacctctggcaatgagacttcgtggaactatactcttgatcaataccaggaa
acttcactagctcaagaaaaagaaaaactgctatatgggttagcatcagtgaggaatgtt
actcttttgtcaaggtatttggatttgctcaaggactcaagcgttattaaaactcaggat
gtgttcacagtcatccgatatatctcatataacagctatgggaagagcatggcctggaac
tgggtacagctcaactgggactatctggtcaacagatacacgatcaatgacagatacctt
ggcagaatcgtcacgatagcagagccattcaacacggagctacagctctggcagatggag
agctttttcaaaaaatatccagaagctggagcaggagaacaaccgagggagcaagtgttg
gaaacagtcagaaacaacatcgagtggctaaaacaaaatagagatgccataaaacaatgg
tttcttgatttatctaggaatggttaa

DBGET integrated database retrieval system