KEGG   Equus caballus (horse): 100073118Help
Entry
100073118         CDS       T01058                                 

Gene name
COX10
Definition
(RefSeq) protoheme IX farnesyltransferase, mitochondrial
  KO
K02257  heme o synthase [EC:2.5.1.141]
Organism
ecb  Equus caballus (horse)
Pathway
ecb00190  Oxidative phosphorylation
ecb00860  Porphyrin and chlorophyll metabolism
ecb01100  Metabolic pathways
ecb04714  Thermogenesis
Module
ecb_M00154  Cytochrome c oxidase
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    100073118 (COX10)
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    100073118 (COX10)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    100073118 (COX10)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:ecb01006]
    100073118 (COX10)
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:ecb03029]
    100073118 (COX10)
Enzymes [BR:ecb01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.141  heme o synthase
     100073118 (COX10)
Prenyltransferases [BR:ecb01006]
 Compound prenylation
  Protoheme farnesyltransferase
   100073118 (COX10)
Mitochondrial biogenesis [BR:ecb03029]
 Mitochondrial quality control factors
  Mitochondrial respiratory chain complex assembly factors
   Complex-IV assembly factors
    100073118 (COX10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UbiA
Motif
Other DBs
NCBI-GeneID: 100073118
NCBI-ProteinID: NP_001138746
Ensembl: ENSECAG00000025173
VGNC: 16797
LinkDB All DBs
Position
11
AA seq 444 aa AA seqDB search
MAASPHTLSSRLLTGWVGGCVWYLERRAMQESPHKFMHLFRNINKQWITFQHFNFLKRMY
VTQLNRSLNQQVKPKPEPVTSPFLEKISSGQAKAEVHELRPISPPSLPLSRKANEKELIE
LESASVIEASIDVGNATKEEKQWKEMKLHVDDLPGILARLSKIKLTALVVSTTSAGFALA
PGPFDWPCFLLTLLGTGLASCAANSINQFFEVPFDSNMNRTKNRPLVRGQISPLLAVSFA
TCCALPGVALLTWGVNPLTGALGVFNIFLYTCCYTPLKRISIANTWVGAVVGAIPPVMGW
TAATGCLDAGAFLLGGILYSWQFPHFNALSWGLREDYSRGGYCMMSVTHPALCRRVALRH
CLALIGLSTAAPILDVTTWTFPVISLPINLYISYLGFRFYRDADRKSSRKLFFCSLWHLP
LFLLLMLTCKQPPGGGSDKGEPQS
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atggctgcctccccgcatactctctcctcacgcctcctgacaggttgggtaggaggatgt
gtctggtacctagaaagaagagctatgcaggaatcccctcacaagtttatgcatcttttc
aggaacatcaacaagcagtggattacatttcagcactttaacttcctcaagcgcatgtat
gtcacacaactgaacagaagcctcaaccagcaagtaaaaccgaagccagaaccagtgaca
tctcctttccttgagaaaatatcttcaggtcaagccaaagcagaagtacatgagttgaga
cctatttcaccccccagcctgcctttgtccagaaaggcaaatgaaaaagaattgatagaa
ctagaatctgcctcagtaattgaagcctcaatagatgtgggaaacgcaacaaaagaggaa
aaacagtggaaagagatgaagctgcatgtggacgatctaccaggaattctggctcgactg
tccaaaatcaaactcacagctcttgtcgtcagcaccacctcagctgggtttgcgctagct
ccgggacctttcgactggccctgtttcctgcttactttgctcgggacaggccttgcgtcc
tgtgctgccaactccatcaatcagttttttgaagtgccgtttgattcaaacatgaataga
acaaagaacagacctctggttcgtggacagatcagcccgttgctagctgtgtcctttgcc
acctgctgtgctcttccaggagttgcccttctgacctggggggtgaatccactcacagga
gccctgggggtcttcaacattttcctgtatacctgctgttataccccgttgaagaggatc
agcattgccaacacgtgggtcggagcagttgttggggccatcccgcctgtcatgggctgg
acagcagctaccggctgcctcgatgctggagcatttcttttgggaggaatcctctactcc
tggcagtttcctcatttcaacgccctgagctggggcctccgcgaagactactcccgagga
ggctactgcatgatgtcagtcactcacccggcactgtgcaggcgcgttgccctgcgccac
tgtctggccttgatcggactgtccacggcagcccccatcctggatgtcaccacatggacc
ttccccgtcatctccctccccatcaacttgtatatttcctacctcggcttccggttctac
agggatgcggaccggaagagttccaggaaactgttcttctgcagcctctggcatctgccc
ttgttcctgcttctcatgctcacctgtaagcagccaccaggtgggggaagtgacaaggga
gaacctcaaagctga

DBGET integrated database retrieval system