KEGG   Equus caballus (horse): 100146253Help
Entry
100146253         CDS       T01058                                 

Gene name
NDUFA13
Definition
(RefSeq) NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13
  KO
K11353  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 13
Organism
ecb  Equus caballus (horse)
Pathway
ecb00190  Oxidative phosphorylation
ecb01100  Metabolic pathways
ecb04714  Thermogenesis
ecb04723  Retrograde endocannabinoid signaling
ecb04932  Non-alcoholic fatty liver disease (NAFLD)
ecb05010  Alzheimer disease
ecb05012  Parkinson disease
ecb05016  Huntington disease
Module
ecb_M00146  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    100146253 (NDUFA13)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    100146253 (NDUFA13)
  09159 Environmental adaptation
   04714 Thermogenesis
    100146253 (NDUFA13)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100146253 (NDUFA13)
   05012 Parkinson disease
    100146253 (NDUFA13)
   05016 Huntington disease
    100146253 (NDUFA13)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100146253 (NDUFA13)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GRIM-19 COX14
Motif
Other DBs
NCBI-GeneID: 100146253
NCBI-ProteinID: XP_023481325
LinkDB All DBs
Position
21
AA seq 144 aa AA seqDB search
MAASKVKQDMPPSGGYGPIDYKRNLPRRGLSGYSMFAVGIGTLLFGYWSMMKWNRERRRL
QIEDFEARIALMPLLQAEKDRRVLQMLRENLEEEAIIMKDVPDWKVGESVFHTTRWVTPM
MGELYGLRTNEEILNATYGFIWYT
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgtcgaaggtgaagcaggacatgccgccgtcggggggctatggccccatcgac
tacaagcggaacctgccgcgtcggggactgtcgggctacagcatgtttgctgtgggcatc
gggaccttgctcttcgggtactggagcatgatgaagtggaaccgtgaacgcaggcgcctg
cagattgaggacttcgaggcccgcattgcactgatgccgttgttgcaggcagagaaggac
cggagggtcctgcagatgcttcgggagaacctggaggaggaagccatcatcatgaaggac
gtgcccgactggaaggtgggtgagtctgtgttccacacaacgcgctgggtgacccccatg
atgggcgagctctatggactacgcacgaatgaggagattctcaatgccacctacggcttc
atatggtacacgtag

DBGET integrated database retrieval system