KEGG   Equus caballus (horse): 100146270
Entry
100146270         CDS       T01058                                 

Definition
(RefSeq) cyclin-dependent kinase 4 inhibitor B
  KO
K06621  cyclin-dependent kinase inhibitor 2A
Organism
ecb  Equus caballus (horse)
Pathway
ecb01522  Endocrine resistance
ecb01524  Platinum drug resistance
ecb04110  Cell cycle
ecb04115  p53 signaling pathway
ecb04218  Cellular senescence
ecb04934  Cushing syndrome
ecb05163  Human cytomegalovirus infection
ecb05166  Human T-cell leukemia virus 1 infection
ecb05200  Pathways in cancer
ecb05203  Viral carcinogenesis
ecb05206  MicroRNAs in cancer
ecb05212  Pancreatic cancer
ecb05214  Glioma
ecb05218  Melanoma
ecb05219  Bladder cancer
ecb05220  Chronic myeloid leukemia
ecb05223  Non-small cell lung cancer
ecb05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100146270
   04115 p53 signaling pathway
    100146270
   04218 Cellular senescence
    100146270
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100146270
   05206 MicroRNAs in cancer
    100146270
   05203 Viral carcinogenesis
    100146270
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100146270
   05225 Hepatocellular carcinoma
    100146270
   05214 Glioma
    100146270
   05220 Chronic myeloid leukemia
    100146270
   05218 Melanoma
    100146270
   05219 Bladder cancer
    100146270
   05223 Non-small cell lung cancer
    100146270
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100146270
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100146270
   05163 Human cytomegalovirus infection
    100146270
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100146270
   01522 Endocrine resistance
    100146270
SSDB
Motif
Pfam: Ank_4 Ank_5 Ank_2 Ank
Other DBs
NCBI-GeneID: 100146270
NCBI-ProteinID: XP_023483200
LinkDB
Position
23
AA seq 202 aa
MNGAAAGGVERPSLGAASVGGERRGGLVTRGWGGPLALHGGGRRGESEGRAMGSSTELLA
DMLCTAAARGRVELVQALLEAGTSPNALNRLGRSPIQVVMMGSVRVAELLLLHGADPNRA
DPVTLTRPVHDAAREGFLDTLVALHRAGARLDVRDAWGRLPVDLAEERGHREVARYLRAA
TGGTEGGGHAGTDPAEGPADVK
NT seq 609 nt   +upstreamnt  +downstreamnt
atgaacggcgctgccgccgggggagtcgagaggccgagtctgggggccgcttccgtcgga
ggagagcgcaggggcgggctggtcacgagaggctggggcgggccgctggctctccacggc
ggcgggaggaggggagagagcgaggggcgagcgatggggagcagcacggagctcttggcc
gacatgctgtgcaccgccgccgcccggggccgggtcgagctggtgcaggcgctgctcgag
gccgggacctcacccaacgcgctgaaccgtctcggtcggagcccgattcaggtcgtgatg
atgggcagcgtccgcgtggccgagctgctgctgctccacggcgccgaccccaaccgtgcc
gaccccgtcaccctcacccgacccgtgcacgacgcggcccgggagggcttcctggacacg
ctggtggcgctgcaccgggccggggcgcggctggacgtgcgcgacgcctggggccgcctg
cccgtggacctggctgaggagcggggccaccgggaggttgcccggtatctgcgcgcggcc
acaggaggcacagagggcggtggccacgctggtaccgaccccgcggaaggccccgcagac
gttaagtga

DBGET integrated database retrieval system