KEGG   Equus caballus (horse): 100146831Help
Entry
100146831         CDS       T01058                                 

Gene name
MAF
Definition
(RefSeq) transcription factor Maf isoform X1
  KO
K09035  transcription factor Maf
Organism
ecb  Equus caballus (horse)
Pathway
ecb04658  Th1 and Th2 cell differentiation
ecb05202  Transcriptional misregulation in cancer
ecb05321  Inflammatory bowel disease (IBD)
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    100146831 (MAF)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    100146831 (MAF)
  09163 Immune disease
   05321 Inflammatory bowel disease (IBD)
    100146831 (MAF)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ecb03000]
    100146831 (MAF)
Transcription factors [BR:ecb03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Maf
    100146831 (MAF)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: bZIP_Maf Maf_N ZapB bZIP_1 bZIP_2 TraT KASH_CCD HOOK NUDE_C APC_N_CC GAS vATP-synt_E JIP_LZII
Motif
Other DBs
NCBI-GeneID: 100146831
NCBI-ProteinID: XP_014593763
Ensembl: ENSECAG00000018532
LinkDB All DBs
Position
3
AA seq 405 aa AA seqDB search
MASELAMSNSDLPTSPLAMEYVNDFDLMKFEVKKEPVETDRIISQCGRLIAGGSLSSTPM
STPCSSVPPSPSFSAPSPGSGSEQKAHLEDYYWMTGYPQQLNPEALGFSPEDAVEALISN
SHQLQGGFDGYARGAQQLASAAGAGAGASLGGSGEEMGPAAAVVSAVIAAAAAQSGAGPH
YHHHHHHHAAGHHHHPTAGAPGAAGSASASAGGAGGAGGGGPASAGGGGGGGGGGGGGGA
AGAGGALHPHHAAGGLHFDDRFSDEQLVTMSVRELNRQLRGVSKEEVIRLKQKRRTLKNR
GYAQSCRFKRVQQRHVLESEKNQLLQQVDHLKQEISRLVRERDAYKEKYEKLVSSGFREN
GSSSDNPSSPEFFITEPTCKLEPSVGYATLWKPQQRVFTTSVFTK
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atggcatcagaactggcaatgagcaactccgacctgcccaccagtcccctggccatggaa
tatgttaatgacttcgatctgatgaagtttgaagtgaaaaaggaaccggtggagaccgac
cgcatcatcagccagtgcggccgtctcatcgccgggggctcgctgtcctccacccccatg
agcacgccgtgcagctcggtgcccccttcccccagcttctcggcgcccagcccgggctcg
ggcagcgagcagaaggcgcacctggaagactactactggatgaccggctacccgcagcag
ctgaaccccgaggcgctgggcttcagcccggaggacgcggtcgaggcgctcatcagcaac
agccaccagctccagggcggcttcgatggctacgcgcgcggggcgcagcagctggcctcg
gcggccggagccggcgccggcgcctccctgggcggcagcggagaggagatgggccccgcc
gccgccgtggtgtccgccgtgatcgccgcggccgcggcgcagagcggcgcgggcccgcac
taccaccaccaccaccaccaccacgccgccggccaccaccaccacccgacggccggcgcg
cccggagccgcgggcagcgcgtccgcctcggccggtggcgcgggcggcgcgggcggcggt
ggcccggccagcgccgggggcggcggcggcggcggcggcggcggaggcggcgggggcgcg
gcgggggcggggggcgccctgcacccgcaccacgccgccggcggcctgcacttcgacgac
cgcttctccgacgagcagctggtgaccatgtcggtgcgcgagctgaaccggcagctgcgc
ggggtcagcaaggaggaggtgatccggctgaagcagaagaggcggaccctgaaaaaccgc
ggctatgcccagtcctgccgcttcaagagggtgcagcagagacacgtcctggagtccgag
aagaaccagctgctgcagcaggtcgaccacctcaagcaggagatctccaggctggtgcgc
gagagggacgcgtacaaggagaaatacgagaagttggtcagcagcggcttccgagaaaac
ggctccagcagcgacaacccgtcctctcccgagtttttcataactgagcccacttgcaag
ttggagccatcagtgggatacgccacactttggaagccccagcaacgtgtattcaccacg
agtgtgttcacaaaatga

DBGET integrated database retrieval system