KEGG   Equus caballus (horse): 100147451
Entry
100147451         CDS       T01058                                 

Gene name
JAK3
Definition
(RefSeq) tyrosine-protein kinase JAK3 isoform X1
  KO
K11218  Janus kinase 3 [EC:2.7.10.2]
Organism
ecb  Equus caballus (horse)
Pathway
ecb04062  Chemokine signaling pathway
ecb04151  PI3K-Akt signaling pathway
ecb04217  Necroptosis
ecb04550  Signaling pathways regulating pluripotency of stem cells
ecb04630  JAK-STAT signaling pathway
ecb04658  Th1 and Th2 cell differentiation
ecb04659  Th17 cell differentiation
ecb05161  Hepatitis B
ecb05162  Measles
ecb05166  Human T-cell leukemia virus 1 infection
ecb05169  Epstein-Barr virus infection
ecb05200  Pathways in cancer
ecb05203  Viral carcinogenesis
ecb05223  Non-small cell lung cancer
ecb05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100147451 (JAK3)
   04151 PI3K-Akt signaling pathway
    100147451 (JAK3)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100147451 (JAK3)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100147451 (JAK3)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    100147451 (JAK3)
   04659 Th17 cell differentiation
    100147451 (JAK3)
   04062 Chemokine signaling pathway
    100147451 (JAK3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100147451 (JAK3)
   05203 Viral carcinogenesis
    100147451 (JAK3)
  09162 Cancer: specific types
   05223 Non-small cell lung cancer
    100147451 (JAK3)
  09163 Immune disease
   05340 Primary immunodeficiency
    100147451 (JAK3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100147451 (JAK3)
   05161 Hepatitis B
    100147451 (JAK3)
   05162 Measles
    100147451 (JAK3)
   05169 Epstein-Barr virus infection
    100147451 (JAK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ecb01001]
    100147451 (JAK3)
Enzymes [BR:ecb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     100147451 (JAK3)
Protein kinases [BR:ecb01001]
 Non-receptor tyrosine kinases
  JAK family [OT]
   100147451 (JAK3)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase FERM_F2 FERM_F1 Jak1_Phl Kdo Kinase-like APH LRR_RI_capping
Other DBs
NCBI-GeneID: 100147451
NCBI-ProteinID: XP_023481218
Ensembl: ENSECAG00000018212
VGNC: 19214
LinkDB
Position
21
AA seq 1116 aa
MDDESEARQAVLMEPPSEETPLIAQRSCSLSSSEAGALHVLLPPRGPGPPQRLSFSFGDH
SAEELCVRAAKASAILPVYHSLFALATEDLSCWFPPSHIFSVEDAGTQVLVYRLRFYFPN
WFGLEKCHRFGLRKDLASAILDLPVLEHLFAQHRNDLLSGRLPVGLGLKEQGECLSLAVL
DLARMAREQAQRPEELLKTVSYKACLPPGLRDLIQGLSFVTRKRIRRTVRRALRRVVACQ
ADRHSLMAKYIMDLERLDPAGAAETFLVGLPGGAGGQDAPGLLRVAGGSGIAWSPGGDEA
LQPFCDFPEIVDISIKQAPRVGPAGEHRLVTVTRTDNQILEAEFPGLPAALSFVALVDGY
FRLTADSRHFFCKEVAPPRLLEEVAEQCHGPITLDFAVNKLKTGGSLPGSYVLRRSPQDF
DSFLLTVCVQTPLGPDYKGCLIRCDPTGTFSLAGLGRPHSSLRELLAACWDGGLHVDGVA
LNLTSCCTPKPKEKSNLIVVRRGCTPPTPSLVQPPSRCQLSQMTFHKIPADSLEWHENLG
HGSFTKIYRGHRHEAVDGEARETEVLLKVMDAKHKNCMESFLEAASLMSQVSYQHLVFLH
GVCMAGDSIMVQEFVRLGALDTYLRKCGHLVPASWKLQVIKQLAYALNYLEDKGLPHGNV
SARKVLLAREGADGSPPFIKLSDPGVSPAVLSLEMLTDRIPWVAPECLQEAHTLGLEADK
WGFGATVWEVFSGVTMPISMLDPAKKLQFYQERQQLPAPKWTELALLIQQCMAYERGLRP
SFRGIIRDLNSLITSDYELLSDPTPGALAPRDGLWNGAQLYACQDPTIYEERHLKYISQL
GKGNFGSVELCRYDPLGDNTGALVAVKQLQHSGPEQQRDFQREVQILRALHSDFIVKYRG
VSYGPGRQSLRLVMEYLPSGCLRDFLQRHRARLHAGRLLLYASQICKGMEYLGSQRCVHR
DLAARNILVESETHVKIADFGLAKLLPLDKDYYVVREPGQSPIFWYAPESLSDNIFSRQS
DVWSFGVVLYELFTYSDKSCSPSAEFLRMMGCERDAPALCRLLELLAEGQRLPAPPACPA
EVHELMKLCWAPSPQDRPPFSALGPQLEALWSGSRG
NT seq 3351 nt   +upstreamnt  +downstreamnt
atggatgatgaaagcgaagcaaggcaggctgtgctcatggagccaccaagcgaggagacg
cccctgatcgctcagcgctcctgcagcctctcgtcttcagaggccggtgctctgcatgtg
ctgctgccccctcggggccctgggcccccgcagcgcctatccttctcctttggggaccat
tcagctgaagagctgtgtgttcgggctgctaaggccagtgccatcctgcccgtgtaccac
tccctctttgctctggccaccgaggacctgtcctgctggttccccccaagccacatcttc
tctgtggaggatgcgggcacccaggtccttgtctacagactccgcttttactttcccaac
tggtttgggctagagaagtgccaccgcttcgggctacgaaaggacttggccagcgccatc
cttgacctgccagtcctggagcacctcttcgcgcagcaccgcaacgatctgctgagcggc
cgcctccccgtgggccttggcctcaaggaacagggcgagtgtctcagcctggccgtgctg
gacctggcccggatggcccgtgagcaggcgcagcggcctgaagagctgctgaagaccgtc
agctacaaggcctgcctgccccccggcctgcgcgatctgatccagggcctgagcttcgtg
actcggaagcgtatccggaggaccgtgcgccgggccctgcgccgcgtggtcgcctgccag
gctgacaggcactcgctcatggccaagtacatcatggacctggagcggctggacccggcc
ggggccgccgagaccttcctcgtgggcctccccgggggtgctggtggtcaggacgcgccc
gggctgctccgcgtggctggtggcagcggcattgcctggagcccgggcggagacgaggcc
ctccagcccttctgcgactttccagaaatcgtggacatcagcatcaagcaggccccgcgc
gttggcccggccggggagcaccgtctggtcaccgtcaccaggacagacaaccagatcctg
gaggccgagttcccggggctgcccgcggccttgtccttcgtggcgctcgtggacggctac
ttccggctgacagccgactcccggcacttcttctgcaaggaggtggcgcccccgcggctg
ctcgaggaggtggccgagcagtgccacggccccatcaccctggattttgcagttaacaag
ctcaagactgggggctcgcttccgggctcctacgttctccgccgcagtccccaggatttt
gacagcttcctcctcactgtctgtgtccagacccccctgggccctgattacaagggctgc
ctcatccggtgcgaccccacgggaaccttctccctggctggcctcgggcgtccccatagc
agtcttcgagaactcctggcagcctgctgggatggtggcctgcatgtggacggagtcgcg
ctgaacctcacctcctgctgcacccctaaacccaaagaaaagtccaatctgattgtggtc
cggagagggtgcaccccacccacgccatccctggttcaacccccatcccgctgccagctg
agtcagatgacgtttcacaagatcccggctgacagcctggagtggcacgagaacctgggt
catgggtccttcaccaagatttaccggggtcatcgccacgaggccgtggacggggaggcc
cgggagacagaggtgctgctgaaagtgatggatgccaagcacaagaactgcatggagtcg
ttcctggaagcagcgagcttgatgagccaagtgtcctaccagcacctcgtgttcctgcat
ggcgtgtgcatggctggagacagcatcatggtgcaggaatttgtccgcctgggggcgctg
gacacatatctgcgcaagtgtggccatctggtgccggccagctggaagctgcaggtgatc
aaacagctggcctatgccctcaactatctggaagacaaaggccttccccatggcaatgtc
tcagcccggaaggtgctcctggctcgggagggggctgacgggagcccgcctttcatcaag
ctgagtgaccctggggtcagccctgctgtgctaagcctggagatgctcaccgacaggatc
ccctgggtggcccctgagtgtctccaggaggcacacacacttggcttggaggctgacaag
tggggcttcggtgccacagtctgggaggtgttcagcggtgtcacgatgcccatcagcatg
ctggaccccgccaagaagctccagttttaccaggaacggcagcagctgccagcccccaag
tggacggagctggcgctgctgatccagcagtgcatggcctacgagcggggcctcaggccc
tccttccgcggcatcatccgtgacctgaacagcctcatcacctcagattatgagctcctc
tcggaccccactcctggtgccctggcgccccgtgacgggctgtggaatggcgcccagctc
tatgcctgccaggaccccaccatctatgaggagaggcacctcaagtacatctcgcagctg
ggcaagggcaacttcggcagcgtggagctgtgccgctatgacccgctgggtgacaacaca
ggcgccctggtggccgtgaagcagctgcagcacagcgggccagagcagcagagggacttc
cagcgggaggtccagatcctgcgagccctgcacagcgacttcatcgtcaagtaccgcggc
gtcagctacggcccaggccgccagagcctgcggctggtcatggagtacctgcccagcggc
tgcctgcgcgacttcctgcagcggcaccgcgcgcgcctccacgccggccgtctgctcctc
tacgcctcgcagatctgcaagggcatggagtacctgggctcccaacgctgcgtgcaccgc
gacctggcagctcggaacatcctggtggagagcgagacgcacgtcaagatcgccgacttc
ggcctcgccaagttgctgccgctcgacaaagactactacgtggtccgcgagcccggccag
agccccattttctggtacgccccagagtcgctctccgacaacatcttctcgcgccagtcg
gacgtctggagcttcggggtggtcctgtacgagctcttcacgtacagcgacaagagctgc
agcccctcggccgagttcctgcgcatgatgggctgtgagcgagacgccccggccctgtgc
cgcctcctggagctgctggccgagggccagaggctgcccgcgcctcctgcctgccccgcc
gaggttcatgagctcatgaagctgtgctgggcccccagcccacaagaccggccgccgttc
agtgccctgggcccccagctggaggcgctgtggagtgggagccgggggtag

DBGET integrated database retrieval system