KEGG   Equus caballus (horse): 100147492Help
Entry
100147492         CDS       T01058                                 

Gene name
C8G
Definition
(RefSeq) complement component C8 gamma chain isoform X1
  KO
K03999  complement component 8 subunit gamma
Organism
ecb  Equus caballus (horse)
Pathway
ecb04610  Complement and coagulation cascades
ecb05020  Prion diseases
ecb05146  Amoebiasis
ecb05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    100147492 (C8G)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    100147492 (C8G)
  09164 Neurodegenerative disease
   05020 Prion diseases
    100147492 (C8G)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100147492 (C8G)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lipocalin
Motif
Other DBs
NCBI-GeneID: 100147492
NCBI-ProteinID: XP_005606008
LinkDB All DBs
Position
25
AA seq 309 aa AA seqDB search
MGGAAGQAEGCGLRPGAGWALRHGSRALPRSAGSRSDVQDEAEFMRSLAGAGDPGPGRRF
EEGGGLTWTSWPGFLGSTGQWTLTWELAIPPSASPSPVMVTAAAMLPPRTVLLTLLLAAA
SLGQRAQRPPRPLSPISTIQPKANFDAQQFAGTWLLVAVASSCRFLQEQGHRAEATALHL
APQGTAMIASTFQKLDGICWQVRQLYRDMGGPGRFQLQARGARGAIDVVVGETDYRSFAI
LYLERARRLSVKLYSTSTSRSLPVSDTALSVFEQRVQGANLTEDHILFFPKYGFCEAADQ
FHVLDEVSR
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgggcggggctgcgggccaggcagagggttgcggtttgagacccggtgccgggtgggcc
ctgagacatggctccagggccctgccacgaagtgcagggtcgaggtcagatgtccaggat
gaggctgagttcatgaggagcctggcaggagccggggaccctggcccagggcggaggttt
gaggagggaggaggactgacgtggacttcctggccggggttcctgggcagcaccggacag
tggactctgacctgggaattggccatcccgccctcagcctcccccagccccgtcatggtc
actgccgctgccatgctgccccccaggactgtactcttgactctgctcttggccgcagcc
tccctgggccagagggctcagagaccccctcggcccctgtcccccatcagcaccattcag
cccaaggccaacttcgacgctcagcagtttgcagggacatggctcctcgtggctgtggcc
tcctcgtgccgcttcctgcaggagcaaggccaccgggctgaggcaaccgcattgcacctg
gctccccagggcacagccatgattgccagcaccttccaaaagctggatgggatctgctgg
caggtgcggcagctctacagagacatgggtggcccgggccgcttccagctccaagcccga
ggtgcccgtggggcgatcgacgtggttgttggggagacggactaccggagcttcgccatc
ctgtacctggagcgggcacggcggctgtcggtgaagctgtacagtacgtccacatcccgc
tcgctccctgtgagcgacacagccctgagtgtgtttgagcagcgggtccagggggccaac
ctgaccgaggaccacatcttgttcttccctaagtatggtttctgtgaggctgcagaccag
ttccacgtcttggatgaagtgagcaggtga

DBGET integrated database retrieval system