KEGG   Equus caballus (horse): 100630736
Entry
100630736         CDS       T01058                                 

Gene name
PDPK1
Definition
(RefSeq) 3-phosphoinositide-dependent protein kinase 1 isoform X1
  KO
K06276  3-phosphoinositide dependent protein kinase-1 [EC:2.7.11.1]
Organism
ecb  Equus caballus (horse)
Pathway
ecb01524  Platinum drug resistance
ecb03320  PPAR signaling pathway
ecb04068  FoxO signaling pathway
ecb04071  Sphingolipid signaling pathway
ecb04140  Autophagy - animal
ecb04150  mTOR signaling pathway
ecb04151  PI3K-Akt signaling pathway
ecb04152  AMPK signaling pathway
ecb04210  Apoptosis
ecb04510  Focal adhesion
ecb04660  T cell receptor signaling pathway
ecb04664  Fc epsilon RI signaling pathway
ecb04722  Neurotrophin signaling pathway
ecb04910  Insulin signaling pathway
ecb04919  Thyroid hormone signaling pathway
ecb04931  Insulin resistance
ecb04960  Aldosterone-regulated sodium reabsorption
ecb05145  Toxoplasmosis
ecb05205  Proteoglycans in cancer
ecb05213  Endometrial cancer
ecb05215  Prostate cancer
ecb05223  Non-small cell lung cancer
ecb05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100630736 (PDPK1)
   04071 Sphingolipid signaling pathway
    100630736 (PDPK1)
   04151 PI3K-Akt signaling pathway
    100630736 (PDPK1)
   04152 AMPK signaling pathway
    100630736 (PDPK1)
   04150 mTOR signaling pathway
    100630736 (PDPK1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100630736 (PDPK1)
  09143 Cell growth and death
   04210 Apoptosis
    100630736 (PDPK1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100630736 (PDPK1)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    100630736 (PDPK1)
   04664 Fc epsilon RI signaling pathway
    100630736 (PDPK1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100630736 (PDPK1)
   03320 PPAR signaling pathway
    100630736 (PDPK1)
   04919 Thyroid hormone signaling pathway
    100630736 (PDPK1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100630736 (PDPK1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100630736 (PDPK1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100630736 (PDPK1)
   05231 Choline metabolism in cancer
    100630736 (PDPK1)
  09162 Cancer: specific types
   05215 Prostate cancer
    100630736 (PDPK1)
   05213 Endometrial cancer
    100630736 (PDPK1)
   05223 Non-small cell lung cancer
    100630736 (PDPK1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100630736 (PDPK1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100630736 (PDPK1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100630736 (PDPK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ecb01001]
    100630736 (PDPK1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ecb04131]
    100630736 (PDPK1)
Enzymes [BR:ecb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100630736 (PDPK1)
Protein kinases [BR:ecb01001]
 Serine/threonine kinases: AGC group
  PDK1 family
   100630736 (PDPK1)
Membrane trafficking [BR:ecb04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Acrosomal exocytosis proteins
    100630736 (PDPK1)
SSDB
Motif
Pfam: Pkinase PH_3 PK_Tyr_Ser-Thr Kinase-like Pkinase_fungal APH Kdo
Other DBs
NCBI-GeneID: 100630736
NCBI-ProteinID: XP_023472293
LinkDB
Position
13
AA seq 585 aa
MLTVASRNLVSHLTAPRPHLPSAVLSCHQLVKDYEYDTVPIQSSVVLCSCPSPSMVRTQT
ESGTAPGVPGGGTRQGPTMDSTAAESRPSANSLQHAAQPPPQPRKKRPEDFKFGKILGEG
SFSTVVLARELATSREYAIKILEKRHIIKENKVPYVTRERDVMSRLDHPFFVKLYFTFQD
DEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYTAEMVSALEYLHGRGVVHRDLKPENI
LLNEDMHIQITDFGTAKVLSPESKQARANSFVGTAQYVSPELLTEKSACKSSDLWALGCI
IYQLVAGLPPFRAGNEYLIFQKIIKLEYDFPEKFFPKARDLVEKLLVLDATKRLGCEEME
GYGPLKAHPFFESITWENLHHQTPPKLTAYLPAMSEDDEDCYGNYDNLLSQFGCMQVSSS
SSSHSLSASDAALPQRAGSNIEQYIHDLDTNSFELDLQFSEDEKRLLLEKQASGNPWHQF
VENNLILKMGPVDKRKGLFARRRQLLLTEGPHLYYVDPVNKVLKGEIPWSQELRPEAKNF
KTFFVHTPNRTYYLMDPSGNAHKWCKKIQEVWRYRYQSHPDAAVQ
NT seq 1758 nt   +upstreamnt  +downstreamnt
atgctcacagtggcctccagaaacctagtgagtcatctcaccgctccacgtcctcatctg
cccagtgcagtactgtcctgccaccagctggttaaggactatgagtatgataccgttcct
attcagtccagcgtggtgttatgttcctgcccatccccatcaatggtgaggacccagact
gaatccggcacggcccctggcgttcctggcggtggtaccaggcagggccccaccatggac
agcaccgcagctgagtccaggccgagtgccaactccttgcaacatgctgcacagccacca
ccacagcctcggaagaaacggcctgaggacttcaaattcgggaaaattcttggtgaaggc
tctttttcaacagttgtcctggcccgagaactggcaacctcaagagaatatgctattaaa
attctagagaaacgtcacattatcaaagagaacaaggtcccgtatgtaaccagagagaga
gacgtgatgtcgcgcctggatcaccccttctttgttaaactttacttcacgtttcaggat
gatgaaaagctgtattttggccttagttatgccaaaaatggagagctacttaaatacatt
cgcaaaatcggttcgttcgatgagacgtgtacccgattttacacggccgagatggtgtct
gccctggagtacttgcacggcaggggcgtcgtccacagggacctgaaaccagaaaacatt
ttgttaaatgaagatatgcacatccagatcacagattttggaactgcaaaagtattatct
cccgagagtaaacaagccagggccaactcgtttgtaggaacagcccagtatgtttctcca
gagctgctcacagagaaatcggcctgtaaaagttcagacctttgggctcttggatgcata
atataccagcttgtggcaggactgccaccattccgagccggaaacgaatatcttatattt
cagaagatcattaaattggaatatgactttcctgaaaaattcttccctaaggcaagagac
cttgtggaaaagcttttggttttagatgccacaaagcgattaggctgtgaagaaatggaa
ggatacggccctctgaaagcccatccattctttgagtccatcacgtgggagaatctgcac
catcagacgcctccaaagctcacagcttacttaccagccatgtcggaagatgatgaagac
tgctatggcaactacgacaatctcctgagccagtttggctgcatgcaggtgtcatcgtca
tcgtcctcccactccttgtctgcctcggacgcagctctgccgcagagggcgggcagcaac
attgagcagtatatccatgacctggacactaattcttttgaactggacttacaattttct
gaagatgagaagaggttattattggagaagcaggccagtggaaacccgtggcatcagttt
gtagaaaataatttaatactaaaaatgggtccagtagataagcgaaagggtttatttgca
cgacgacgacagttactactcacagaagggccacacttatattatgttgatcctgtcaac
aaagtcctgaaaggtgaaattccatggtcacaagaactccgaccagaggccaagaatttt
aaaaccttctttgtccacacgccaaacaggacatattacctgatggacccgagcgggaat
gctcacaaatggtgcaaaaagatccaggaggtgtggaggtacagataccagagccaccca
gatgccgctgtgcagtga

DBGET integrated database retrieval system