KEGG   Equus caballus (horse): 102149114
Entry
102149114         CDS       T01058                                 

Gene name
CCND1
Definition
(RefSeq) G1/S-specific cyclin-D1
  KO
K04503  G1/S-specific cyclin-D1
Organism
ecb  Equus caballus (horse)
Pathway
ecb01522  Endocrine resistance
ecb04068  FoxO signaling pathway
ecb04110  Cell cycle
ecb04115  p53 signaling pathway
ecb04151  PI3K-Akt signaling pathway
ecb04152  AMPK signaling pathway
ecb04218  Cellular senescence
ecb04310  Wnt signaling pathway
ecb04340  Hedgehog signaling pathway
ecb04371  Apelin signaling pathway
ecb04390  Hippo signaling pathway
ecb04510  Focal adhesion
ecb04530  Tight junction
ecb04630  JAK-STAT signaling pathway
ecb04917  Prolactin signaling pathway
ecb04919  Thyroid hormone signaling pathway
ecb04921  Oxytocin signaling pathway
ecb04933  AGE-RAGE signaling pathway in diabetic complications
ecb04934  Cushing syndrome
ecb05160  Hepatitis C
ecb05162  Measles
ecb05163  Human cytomegalovirus infection
ecb05165  Human papillomavirus infection
ecb05166  Human T-cell leukemia virus 1 infection
ecb05167  Kaposi sarcoma-associated herpesvirus infection
ecb05169  Epstein-Barr virus infection
ecb05200  Pathways in cancer
ecb05203  Viral carcinogenesis
ecb05205  Proteoglycans in cancer
ecb05206  MicroRNAs in cancer
ecb05210  Colorectal cancer
ecb05212  Pancreatic cancer
ecb05213  Endometrial cancer
ecb05214  Glioma
ecb05215  Prostate cancer
ecb05216  Thyroid cancer
ecb05218  Melanoma
ecb05219  Bladder cancer
ecb05220  Chronic myeloid leukemia
ecb05221  Acute myeloid leukemia
ecb05222  Small cell lung cancer
ecb05223  Non-small cell lung cancer
ecb05224  Breast cancer
ecb05225  Hepatocellular carcinoma
ecb05226  Gastric cancer
ecb05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    102149114 (CCND1)
   04340 Hedgehog signaling pathway
    102149114 (CCND1)
   04390 Hippo signaling pathway
    102149114 (CCND1)
   04371 Apelin signaling pathway
    102149114 (CCND1)
   04630 JAK-STAT signaling pathway
    102149114 (CCND1)
   04068 FoxO signaling pathway
    102149114 (CCND1)
   04151 PI3K-Akt signaling pathway
    102149114 (CCND1)
   04152 AMPK signaling pathway
    102149114 (CCND1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102149114 (CCND1)
   04115 p53 signaling pathway
    102149114 (CCND1)
   04218 Cellular senescence
    102149114 (CCND1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102149114 (CCND1)
   04530 Tight junction
    102149114 (CCND1)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    102149114 (CCND1)
   04921 Oxytocin signaling pathway
    102149114 (CCND1)
   04919 Thyroid hormone signaling pathway
    102149114 (CCND1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102149114 (CCND1)
   05206 MicroRNAs in cancer
    102149114 (CCND1)
   05205 Proteoglycans in cancer
    102149114 (CCND1)
   05203 Viral carcinogenesis
    102149114 (CCND1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102149114 (CCND1)
   05212 Pancreatic cancer
    102149114 (CCND1)
   05225 Hepatocellular carcinoma
    102149114 (CCND1)
   05226 Gastric cancer
    102149114 (CCND1)
   05214 Glioma
    102149114 (CCND1)
   05216 Thyroid cancer
    102149114 (CCND1)
   05221 Acute myeloid leukemia
    102149114 (CCND1)
   05220 Chronic myeloid leukemia
    102149114 (CCND1)
   05218 Melanoma
    102149114 (CCND1)
   05219 Bladder cancer
    102149114 (CCND1)
   05215 Prostate cancer
    102149114 (CCND1)
   05213 Endometrial cancer
    102149114 (CCND1)
   05224 Breast cancer
    102149114 (CCND1)
   05222 Small cell lung cancer
    102149114 (CCND1)
   05223 Non-small cell lung cancer
    102149114 (CCND1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    102149114 (CCND1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102149114 (CCND1)
   04934 Cushing syndrome
    102149114 (CCND1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102149114 (CCND1)
   05162 Measles
    102149114 (CCND1)
   05160 Hepatitis C
    102149114 (CCND1)
   05163 Human cytomegalovirus infection
    102149114 (CCND1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102149114 (CCND1)
   05169 Epstein-Barr virus infection
    102149114 (CCND1)
   05165 Human papillomavirus infection
    102149114 (CCND1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102149114 (CCND1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 102149114
NCBI-ProteinID: XP_023510387
Ensembl: ENSECAG00000020257
LinkDB
Position
12
AA seq 295 aa
MAHQLLCCEVETIRRAYPDANLLNDRVLRAMLKAEETCAPSVSYFKCVQKEILPSMRKIV
ATWMLEVCEEQKCEEEVFPLAMNYLDRFLSLEPVKKSRLQLLGATCMFVASKMKETIPLT
AEKLCIYTDNSIRPDELLQMELLLVNKLKWNLAAMTPHDFIEHFLSKMPVAEDNKQVIRK
HAQTFVALCATDVKFISNPPSMVAAGSVVAAVQGLHLGSTNSFLSYHRLTRFLSKVIKCD
PDCLRACQEQIEALLESSLRQAQQQNLDPKAAEEEEEEEEVDLACTPTDVRDVNI
NT seq 888 nt   +upstreamnt  +downstreamnt
atggcacaccagcttctgtgctgcgaggtggagaccatccgccgggcataccccgatgcc
aacctcctcaacgaccgggtgctgcgggccatgctcaaggcggaggagacctgcgcgccc
tcggtgtcctacttcaagtgtgtgcagaaggagatcctcccgtccatgaggaagatcgtg
gccacctggatgctggaggtctgcgaggagcagaagtgcgaggaggaagtcttcccgctg
gccatgaactacctggaccgcttcctgtcgctggagcccgtgaaaaagagccgcctgcag
ctgctgggggccacctgcatgttcgtggcctcgaagatgaaggagaccatccccctgacg
gccgagaagttgtgcatttacacggacaactccatccggcccgacgagctgctgcaaatg
gagctgctcctggtgaacaagctcaagtggaacctggcggccatgaccccgcacgatttc
atcgagcacttcctctccaaaatgccggtggccgaggacaacaagcaggtcatccgcaag
cacgctcagaccttcgtcgccctctgtgccacagacgtgaagttcatttccaacccgccc
tccatggtggctgccgggagcgtggtggccgcggtgcaaggcctgcacctggggagcacc
aacagcttcctgtcctaccaccgcctcacacggttcctctccaaagtgatcaagtgtgac
ccggactgcctgcgggcctgccaggagcagatcgaggccctgctggagtccagcctgcgc
caggcccagcagcagaacctggaccccaaggccgcggaggaggaggaggaggaggaggag
gtggacctggcctgcacgcccaccgacgtgcgggacgtgaacatttga

DBGET integrated database retrieval system