KEGG   Equus caballus (horse): 106781070
Entry
106781070         CDS       T01058                                 

Definition
(RefSeq) granulocyte-macrophage colony-stimulating factor receptor subunit alpha isoform X1
  KO
K04737  interleukin 3 receptor alpha
Organism
ecb  Equus caballus (horse)
Pathway
ecb04060  Cytokine-cytokine receptor interaction
ecb04151  PI3K-Akt signaling pathway
ecb04210  Apoptosis
ecb04630  JAK-STAT signaling pathway
ecb04640  Hematopoietic cell lineage
ecb05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    106781070
   04151 PI3K-Akt signaling pathway
    106781070
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    106781070
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    106781070
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    106781070
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    106781070
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ecb04050]
    106781070
   04090 CD molecules [BR:ecb04090]
    106781070
Cytokine receptors [BR:ecb04050]
 Interleukin receptor families
  IL3 receptor family
   106781070
CD molecules [BR:ecb04090]
 Proteins
  106781070
SSDB
Motif
Pfam: IL3Ra_N IL6Ra-bind EpoR_lig-bind
Other DBs
NCBI-GeneID: 106781070
NCBI-ProteinID: XP_023489714
LinkDB
Position
X
AA seq 644 aa
MQEAGRPVQLWGWGAAAPLDPVGLLVLLSWASCGHPARAQESVSPILNMKLDSRTKTLSW
NYRRNVTEQECKIDTPPDDSTSKTPQVNGNDTYFCEFPNSVLHRGANLTLNVNSEGAAFQ
EVLVFHNSGPEGSGAVNFSCFIYDLRFLNCSWSPGPAAPPDVRYHLYWWASSHDPEVECA
RYIVDPAGTRVGCHLDDLGDPKTTDYFFLVNGTSNRTAVRFLDFTPFRAKLMEKYRPPAN
VTTAFNGSHHVVRWDDPETRFDVASHMLCYQLDIRRQGSSYKRDPVFQRGSDGNQYVLPG
SAVTAGDTVRARVKHVYGDIWSAWSRAVDFNRPEPDPAGALAGLVVPAVTAAAALVGVLM
FVCKRFSLRRRLFPRVPRVRMQRAGSFPPDLERTRPPAGPMAFVWITLFLTPTSGLLRPD
QDPSPPIRNVRMEPESQRLTWDLHGNVSGIECSQSLEYNVTARKNQYCQFPVLPSCGSKN
YTVFVTGGQPFSTSIGYPEPEGNPGAAAQNLTCWVHDVDFLTCRWAVGSAAPRDVQYHLH
VGEARTSEGRECPGYTADERGTHVRCRFDDLSGFSNGLYRFRVRGTSRASGIPCSEMFEQ
LSRIARPCPQMVTASSPVKPGPDPAGPRPRGRLADALRGWCEKK
NT seq 1935 nt   +upstreamnt  +downstreamnt
atgcaggaagctggccgaccggtccagctgtggggctggggcgccgcggccccactggat
cccgtcggcctcctggtgctgctgagctgggcgagctgcgggcacccagcgcgggcacag
gagagcgtgtcccccattctgaacatgaagctggattcgaggacgaaaacgctgagctgg
aattacaggcggaacgtgactgagcaggagtgcaaaatcgacacgccgcccgacgactcg
acctccaagaccccgcaggtcaatgggaacgacacctacttctgcgagttccccaactcg
gtgctgcaccggggggccaacctgacgctcaacgtcaactccgagggggccgcgttccag
gaagtcctggttttccacaactcaggcccggaaggttccggggccgtgaacttctcctgc
tttatctacgacctccgcttcctcaactgcagctggagccccggcccggccgccccgccc
gacgtccggtaccacctctactggtgggcgtccagtcacgacccggaggtcgagtgcgcc
cgctacatcgtggaccccgcggggacgcgcgtgggctgccacctggacgacctcggggac
cccaagacgaccgactacttcttcctggtcaacggcaccagcaaccgcaccgccgtccgc
ttcctggacttcacgccgtttcgggccaagctgatggagaagtatcggccgcctgccaac
gtcaccaccgccttcaatggctcccaccacgtcgtccgctgggacgaccccgagacccgg
tttgacgtcgcgagtcatatgctgtgctaccaactggacatccgacgacagggcagctcc
tacaagagagaccccgttttccaacggggtagtgacgggaatcagtacgtgctgcccggc
tctgcggtgacggcgggggacacggtgcgggcgcgggtgaagcacgtgtacggcgacatc
tggagcgcgtggagccgggccgtggacttcaaccgcccggagccggatcccgcgggcgcg
ctcgcgggtctggtggtgccggcggtgacggcggcggcagcgctcgtcggggtgctgatg
ttcgtgtgcaaaaggttctcgctgcggcgccggctgttcccgcgcgtcccgcgggtgcgg
atgcagcgcgctgggtccttcccgcccgacctggagcgcacacgcccgcccgccggcccc
atggccttcgtctggatcacgctgttcctgacccccacctccggcctgctgcgcccggac
caggatccgagcccgccgattcggaatgtgaggatggagccggaaagtcagagactgacc
tgggacctccacggaaatgtgagcgggatcgagtgctcgcaaagcctggagtacaacgtc
acggccagaaaaaaccagtactgccagtttccagtgcttccctcgtgcggatcgaaaaac
tacacggtgttcgtgaccggagggcagccattctcaacgtcgattggctaccctgagccg
gaagggaaccctggggcggccgcccagaacctcacgtgctgggtccacgatgtggatttc
ctgacgtgccgctgggccgtgggcagcgcggcgcccagagacgtccagtaccacctgcac
gtgggggaggcgaggacctccgaggggcgggagtgtccgggttacacggcggacgagcgg
gggacacacgtgcggtgccgtttcgacgacctctctgggttctccaacgggctgtaccgg
ttccgagtgaggggcaccagccgagcttccggaatcccctgctcggagatgttcgaacaa
ttatcgcgaatcgctagaccctgtccgcaaatggtgacggcttcgagccccgtgaaacct
gggcccgacccggctggtccgcgtccacgaggccggctggctgatgcgttgagaggatgg
tgcgagaagaaatga

DBGET integrated database retrieval system