KEGG   Equus caballus (horse): 106782874
Entry
106782874         CDS       T01058                                 

Gene name
EGF
Definition
(RefSeq) pro-epidermal growth factor isoform X1
  KO
K04357  epidermal growth factor
Organism
ecb  Equus caballus (horse)
Pathway
ecb01521  EGFR tyrosine kinase inhibitor resistance
ecb04010  MAPK signaling pathway
ecb04012  ErbB signaling pathway
ecb04014  Ras signaling pathway
ecb04015  Rap1 signaling pathway
ecb04020  Calcium signaling pathway
ecb04066  HIF-1 signaling pathway
ecb04068  FoxO signaling pathway
ecb04072  Phospholipase D signaling pathway
ecb04151  PI3K-Akt signaling pathway
ecb04510  Focal adhesion
ecb04540  Gap junction
ecb04630  JAK-STAT signaling pathway
ecb04810  Regulation of actin cytoskeleton
ecb05160  Hepatitis C
ecb05165  Human papillomavirus infection
ecb05200  Pathways in cancer
ecb05210  Colorectal cancer
ecb05212  Pancreatic cancer
ecb05213  Endometrial cancer
ecb05214  Glioma
ecb05215  Prostate cancer
ecb05218  Melanoma
ecb05219  Bladder cancer
ecb05223  Non-small cell lung cancer
ecb05224  Breast cancer
ecb05226  Gastric cancer
ecb05231  Choline metabolism in cancer
ecb05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106782874 (EGF)
   04012 ErbB signaling pathway
    106782874 (EGF)
   04014 Ras signaling pathway
    106782874 (EGF)
   04015 Rap1 signaling pathway
    106782874 (EGF)
   04630 JAK-STAT signaling pathway
    106782874 (EGF)
   04066 HIF-1 signaling pathway
    106782874 (EGF)
   04068 FoxO signaling pathway
    106782874 (EGF)
   04020 Calcium signaling pathway
    106782874 (EGF)
   04072 Phospholipase D signaling pathway
    106782874 (EGF)
   04151 PI3K-Akt signaling pathway
    106782874 (EGF)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106782874 (EGF)
   04540 Gap junction
    106782874 (EGF)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    106782874 (EGF)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    106782874 (EGF)
   05231 Choline metabolism in cancer
    106782874 (EGF)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    106782874 (EGF)
  09162 Cancer: specific types
   05210 Colorectal cancer
    106782874 (EGF)
   05212 Pancreatic cancer
    106782874 (EGF)
   05226 Gastric cancer
    106782874 (EGF)
   05214 Glioma
    106782874 (EGF)
   05218 Melanoma
    106782874 (EGF)
   05219 Bladder cancer
    106782874 (EGF)
   05215 Prostate cancer
    106782874 (EGF)
   05213 Endometrial cancer
    106782874 (EGF)
   05224 Breast cancer
    106782874 (EGF)
   05223 Non-small cell lung cancer
    106782874 (EGF)
  09172 Infectious disease: viral
   05160 Hepatitis C
    106782874 (EGF)
   05165 Human papillomavirus infection
    106782874 (EGF)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    106782874 (EGF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ecb04052]
    106782874 (EGF)
Cytokines and growth factors [BR:ecb04052]
 Growth factors
  Growth factors (RTK binding)
   106782874 (EGF)
SSDB
Motif
Pfam: Ldl_recept_b FXa_inhibition cEGF EGF_CA EGF EGF_3 DUF5050 Plasmod_Pvs28 Tr-sialidase_C
Other DBs
NCBI-GeneID: 106782874
NCBI-ProteinID: XP_014593426
Ensembl: ENSECAG00000010741
VGNC: 17456
LinkDB
Position
2
AA seq 1209 aa
MLLFLSTLLPAVFAAAFVSVSARPRWDCPAGPPSGKGHSPCVGPVPFLIFSYGNSIFRID
LEGTNHEQLVTDAGISVIMDFHYNKGRIYWVDLARQLLQSVLLNGTRQERICNIERNVSG
MAINWINEELIWSNQEEGVITVTDMKGNNSRVLLGTLKSPANIAVDPVERLLFWSSEAAG
SLHRADLNGVEEKVLLETSGKITAVSLDVLEKRLFWIQYDREGDNSRVCSSDYDGGSVRC
CKHLTQHNLVAVSLFGDRIFYSTWRKQTIEIADKYTGKDVVRINLSRSFAPPAGIKAVHP
LMQPEADGGAQASDQKVCKLRKSDCRGSVCGQDPKSHLCACVEGYTLSQDGKSCEDVNEC
AFWNHGCTLGCENIPGSYYCTCPVGFVLLPDGKRCHELISCPSNASECSHDCVLTSDGPL
CFCPEGSVLETDGKTCSGCSSPDNGGCSQLCIPLSPASWECSCFPGYDLQLDQKSCAASG
PQPFLLFANSKDIRHMRFDGTDYGILLSQQMGAVFALDHDPVENKIYFAHTALKWIERAN
MDGSQRERLVEEAVDVPEGLAVDWIGRKLYWTDRGKALIEGSDLNGKFREIIVREDISQP
RGIAVHPMAKRLFWTDMGINPRIESSSLQGTGRLVIVSSDLAWPSGITIDYLTDKLYWCD
AKKSVIEMADLDGSKRRRLAQNDVGHPFAVAVFEDHVWFSDWTVPSVIRVNKRTGKNRVR
LRGSMLKPSSLVIVHPLAKPGADPCSHQNGGCEHTCKERFGTAQCLCREGFMKAPDGKMC
LALNGHQILAGSEADLSGQTTPLGILSRSRGCEDNISESQQMLVAEIMVSDDDDCGPVRC
GPHAQCVSEGEEAICQCFKGFAGDGQLCSDVDECEVGNLVCPHPSSRCVNTEGGYVCQCS
EGYRGDGMHCLDIDECQLGMHTCGENASCTNTEGNYTCLCAGGLSGPGWICPNSTVPSPP
REDGHYSVRNSYQECSQSYDGYCLHGGKCVYLVQVDTHACNCVVGYVGERCQHQDLRWWE
LRHTGHGWPRSITVVAVCMVVLILLLLLGLWGAHYHRAQKLLLKNPKNPYEESSRDMSGN
RPADSEAGMSSCPQPWFVVIKEQQQNLRSGDQPVHPKDGETADVGQFSSLEPGSLQQTSW
RKEPQMYTGTEQGCCIPPSSGKGSGPQAMECSFHLPSYGARPAATGVEKPHSLLSANPLW
QQRAPDPPL
NT seq 3630 nt   +upstreamnt  +downstreamnt
atgctgctcttccttagcactctgttgccagcagtttttgcagctgctttcgttagcgtc
tccgcacggccgcgctgggactgtcctgcaggccctccctcgggaaaggggcattctccc
tgtgtgggtcctgtgcccttcttaattttctcctatggaaatagtatctttaggattgat
ctggaaggaactaatcatgagcaattggtgacagatgctggcatatcggtcatcatggat
tttcattacaacaagggaagaatctattgggtagatctagcaagacaacttttgcaaagc
gttcttctgaatgggacaaggcaagagagaatatgcaatatagagagaaatgtttcagga
atggcaataaattggataaatgaagaacttatttggtcaaatcaagaggaaggagtcatt
acagtaacagatatgaaaggaaacaattcccgtgttctcttgggcaccttaaaatctcct
gcaaacatagcagttgatccagtagaaaggcttctcttctggtcttcagaggcggccggc
agcctccacagagcagatctcaatggtgtggaagagaaggttctgttagagacatcaggg
aaaataacagctgtgtcactggatgtgcttgagaagcggctcttttggattcagtacgac
agagagggcgacaattcccgtgtttgttccagcgattatgacggagggtctgtccgttgc
tgcaaacatcttacacagcacaacttggttgcagtgtccctctttggtgaccgtatcttc
tattcaacgtggagaaaacagacaattgagatagctgacaaatacactgggaaggatgtg
gttagaattaacctcagtcggtcctttgcaccacctgctggaattaaagctgtgcatccc
ctcatgcagcctgaggcagatggcggtgcgcaggcatctgaccagaaagtctgcaaactg
aggaaaagtgactgcagaggcagcgtgtgtgggcaagaccctaagtcccatctgtgcgca
tgtgtggagggatatactttaagccaagacgggaagtcctgtgaagatgtcaatgaatgt
gccttttggaatcatggctgtactcttgggtgtgaaaacatccctggatcctattattgc
acatgccctgtaggatttgttctgcttcctgatgggaaacggtgtcatgaattaatttcc
tgcccaagcaacgcatccgaatgcagccatgactgtgttctgacctcagatgggcccctg
tgtttctgtcctgaaggctcagtgcttgagacagatggaaaaacgtgtagtggctgttca
tcacctgataacggtggatgcagccagctctgcatcccgctcagcccagcatcctgggaa
tgtagttgctttcctggctacgacctacaattggaccagaaaagttgtgcagcttcagga
ccacaaccgtttttgctgtttgccaattctaaagatattcgacacatgcgttttgatgga
acagattatggaatcctgctcagccagcagatgggggcagtttttgccctagatcatgac
cctgtggaaaataagatctactttgcccatacagccctgaagtggatcgagagagctaac
atggatggttcccagcgagaaaggcttgttgaggaagccgttgatgtgccagaaggtctt
gctgtagactggattggccgcaaactctactggacagacagagggaaagctctcattgaa
gggagtgatttaaatggaaaattccgtgaaatcatcgttcgggaggacatctctcagcca
cgaggcattgctgtccatcccatggccaagagattattctggactgatatggggattaat
ccacgaattgaaagttcttcccttcaaggcactggccgtctggttatagttagctctgat
ctggcctggcccagtggaataacgattgattacttaactgacaagttgtattggtgcgat
gccaagaagtctgtgatagaaatggccgatctggatggttcaaaacgccgaagacttgcc
cagaacgatgtagggcacccgtttgctgtggccgtgtttgaggatcacgtgtggttctct
gattggactgtgccatcagtaataagggtgaacaagcggactggcaaaaacagggtacgt
ctccgaggcagcatgctgaagccctcatcactggttatagttcatccattggcaaaacca
ggagcagatccctgctcacatcaaaatggaggctgtgaacacacctgcaaagaaaggttt
ggaactgctcagtgtttgtgtcgtgaaggttttatgaaagccccagatgggaaaatgtgt
ctggctctgaatggccatcagatattggcaggtagtgaagcagatctaagtggtcaaaca
acgccattgggcatcttatccaggagtagagggtgtgaagataacatttcagaatctcag
caaatgctagtggctgaaatcatggtgtcagatgatgatgactgtggccccgtgcgatgc
ggtccccacgcccagtgtgtttcagagggagaggaggccatatgtcagtgtttcaaagga
ttcgctggggatggacagctatgttctgatgtggatgaatgtgaggtgggaaacttggtg
tgcccccacccctcctctcggtgcgtcaacactgaaggtggctatgtctgccagtgctcg
gaaggctaccgaggcgatgggatgcattgtctagatattgatgagtgccaactgggcatg
cacacctgtggagaaaatgccagctgtacaaatacagaaggaaactatacctgcctgtgt
gctggtggcctgtctggacctggatggatttgccccaactcgactgtaccctctcctccc
agggaggatggccactactctgtgagaaatagttaccaggaatgttcccagtcctatgac
gggtactgcctccacggtggcaagtgtgtgtatcttgtacaagtcgacacacatgcgtgc
aactgtgttgttggctacgtcggagagcgatgtcagcaccaggacttgaggtggtgggaa
ctgcgccacaccggccacgggtggccccggagcatcaccgtggtggccgtctgcatggtg
gtgctcatcctgctgctgctgctgggcctgtggggggctcactaccacagggctcagaag
ctgctattgaaaaatccaaagaatccttatgaagagtcaagcagagatatgagcggcaac
aggcctgcagacagcgaggctggcatgtcctcttgcccccaaccttggtttgtggttata
aaggaacaacagcaaaacctcaggagtggggatcaacctgtgcaccccaaggacggcgag
acagcagatgttggccagttttcctccctggagcctgggtcattgcaacagacatcgtgg
aggaaggagccccagatgtatacgggcacagaacaaggttgctgcattccaccgtccagt
ggcaaaggctccgggccccaggcaatggagtgtagctttcatctcccctcctatggggca
cggcccgctgctacgggggttgagaagcctcattctctcctgtcagctaacccgttatgg
caacagagagccccagatccaccgctctaa

DBGET integrated database retrieval system