KEGG   Equus caballus (horse): 111773925
Entry
111773925         CDS       T01058                                 

Gene name
CDKN1B
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
ecb  Equus caballus (horse)
Pathway
ecb01522  Endocrine resistance
ecb04012  ErbB signaling pathway
ecb04066  HIF-1 signaling pathway
ecb04068  FoxO signaling pathway
ecb04110  Cell cycle
ecb04151  PI3K-Akt signaling pathway
ecb04933  AGE-RAGE signaling pathway in diabetic complications
ecb04934  Cushing syndrome
ecb05162  Measles
ecb05165  Human papillomavirus infection
ecb05169  Epstein-Barr virus infection
ecb05200  Pathways in cancer
ecb05202  Transcriptional misregulation in cancer
ecb05203  Viral carcinogenesis
ecb05206  MicroRNAs in cancer
ecb05215  Prostate cancer
ecb05220  Chronic myeloid leukemia
ecb05222  Small cell lung cancer
ecb05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    111773925 (CDKN1B)
   04066 HIF-1 signaling pathway
    111773925 (CDKN1B)
   04068 FoxO signaling pathway
    111773925 (CDKN1B)
   04151 PI3K-Akt signaling pathway
    111773925 (CDKN1B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    111773925 (CDKN1B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111773925 (CDKN1B)
   05202 Transcriptional misregulation in cancer
    111773925 (CDKN1B)
   05206 MicroRNAs in cancer
    111773925 (CDKN1B)
   05203 Viral carcinogenesis
    111773925 (CDKN1B)
  09162 Cancer: specific types
   05226 Gastric cancer
    111773925 (CDKN1B)
   05220 Chronic myeloid leukemia
    111773925 (CDKN1B)
   05215 Prostate cancer
    111773925 (CDKN1B)
   05222 Small cell lung cancer
    111773925 (CDKN1B)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    111773925 (CDKN1B)
   04934 Cushing syndrome
    111773925 (CDKN1B)
  09172 Infectious disease: viral
   05162 Measles
    111773925 (CDKN1B)
   05169 Epstein-Barr virus infection
    111773925 (CDKN1B)
   05165 Human papillomavirus infection
    111773925 (CDKN1B)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    111773925 (CDKN1B)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 111773925
NCBI-ProteinID: XP_023498912
LinkDB
Position
6
AA seq 198 aa
MSNVRVSNGSPSLERMDARQAEYPKPSACRNLFGPVNHEELTRDLEKHCRDMEEASQRKW
NFDFQNHKPLEGKYEWQEVEKGSLPEFYYRPPRPPKGACKVPAQESQDASANRQAVPLIG
SQANSEDTHLVDPKTDTSDSPTGLAEPCTGIRKRPAADDSSPQNKRANRTEENVSDGSPN
AGSVEQTPKKPGLRRRQT
NT seq 597 nt   +upstreamnt  +downstreamnt
atgtcaaacgtgcgagtgtccaacgggagcccgagcctggagcggatggacgccagacag
gcggagtaccccaagccgtccgcctgcagaaacctcttcggtccggtgaatcacgaagag
ttaacccgggacttggagaagcactgccgagacatggaagaggccagccagcgcaagtgg
aattttgatttccagaatcacaagcccctggagggcaaatacgagtggcaggaggtggaa
aagggcagcttgcccgagttctactacagacccccgcggccacccaaaggcgcctgcaag
gtgccggcgcaggagagccaggatgccagcgcgaaccgccaggcggtgcctttaattggg
tctcaggcaaactcagaggacacgcatttggtagacccaaagactgatacgtcggacagc
cccacgggcttagcggagccgtgcactgggatcaggaagcgacctgcagcagacgattcc
tctcctcaaaacaaaagagccaacagaacagaagaaaatgtttcagacggttccccgaac
gcgggctcagtggagcagacgcccaagaagccgggcctccgaagacgtcaaacgtaa

DBGET integrated database retrieval system